BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0098.Seq (846 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0401 - 33678814-33679185,33679564-33679676,33679785-336798... 31 0.87 02_03_0217 + 16512689-16512838,16514353-16515444 29 6.2 >03_06_0401 - 33678814-33679185,33679564-33679676,33679785-33679834, 33680024-33680103,33680541-33680635,33681079-33681124 Length = 251 Score = 31.5 bits (68), Expect = 0.87 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -3 Query: 703 GDFFIYRCICFWCEVIFTK 647 GD F Y+CIC W +++ TK Sbjct: 15 GDSFCYKCICQWVKIVSTK 33 >02_03_0217 + 16512689-16512838,16514353-16515444 Length = 413 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 Query: 308 STTNLIETPNILTKFQILQYFITAKMVDDD 219 S TN+I+ P + K ++LQY K+ DD Sbjct: 55 SGTNIIKLPKTIIKLKMLQYLRAGKVPKDD 84 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,747,735 Number of Sequences: 37544 Number of extensions: 301938 Number of successful extensions: 437 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 437 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2350456800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -