BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ps4M0098.Seq
(846 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY060474-1|AAL25513.1| 133|Drosophila melanogaster SD06722p pro... 32 1.1
>AY060474-1|AAL25513.1| 133|Drosophila melanogaster SD06722p
protein.
Length = 133
Score = 31.9 bits (69), Expect = 1.1
Identities = 14/39 (35%), Positives = 26/39 (66%)
Frame = -3
Query: 631 NLLTAIIYNQQYIQYVKCLCI*KRIYVCLYVQLKLSYVV 515
+L T II ++Q+ Q + C+C+ +IY LY+ + +S V+
Sbjct: 56 SLYTMIIQSEQFTQCMCCVCVCSQIYY-LYIYIYISIVI 93
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,288,331
Number of Sequences: 53049
Number of extensions: 573665
Number of successful extensions: 879
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 842
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 879
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4044853644
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -