BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0096.Seq (835 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 25 0.86 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 4.6 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 4.6 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 8.0 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 25.0 bits (52), Expect = 0.86 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -1 Query: 58 ARAEFLQPGGSTSSRAA 8 A+ EFL PGGS R A Sbjct: 66 AKCEFLNPGGSVKDRIA 82 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.6 bits (46), Expect = 4.6 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = -2 Query: 483 MSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLT 349 M C P DT +Y+F R Y + T VI + + TLT Sbjct: 230 MYACCP--NDTYPMIVYEFSISRHYGILHATYVIPAVTMMLLTLT 272 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 4.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 39 CRNSARAPVP 68 CRNS R PVP Sbjct: 1333 CRNSRRTPVP 1342 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 8.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -3 Query: 611 SHDVVKRRPVNCNTTHYRANWVPGP 537 S + K++P +C+T YR V P Sbjct: 560 SDECNKKQPSDCDTLEYRNGEVTTP 584 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 240,443 Number of Sequences: 438 Number of extensions: 5160 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26702940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -