BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0095.Seq (802 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC364.01 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||... 27 4.1 SPBC15D4.03 |slm9||hira protein Slm9|Schizosaccharomyces pombe|c... 25 9.5 >SPCC364.01 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 320 Score = 26.6 bits (56), Expect = 4.1 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 39 SLPRSSENQQXRTEIIFXYSMHETXQAAFXARFEHSNLFKVKLSA 173 SL RS ++ +I F ++M E + + +H NL KLS+ Sbjct: 71 SLDRSLPSENTIDQISFNHAMSEEDASGYQIGDKHKNLLLYKLSS 115 >SPBC15D4.03 |slm9||hira protein Slm9|Schizosaccharomyces pombe|chr 2|||Manual Length = 807 Score = 25.4 bits (53), Expect = 9.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -1 Query: 88 NMISVLXCWFSELRGND 38 N +S+L C FS L GND Sbjct: 476 NQLSLLKCTFSNLDGND 492 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,634,109 Number of Sequences: 5004 Number of extensions: 44674 Number of successful extensions: 78 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 388424860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -