BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0095.Seq (802 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5) 28 7.7 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 538 DVVAXSQAPSPESNPDSP 591 DVVA SQAPSPESNP+SP Sbjct: 105 DVVAVSQAPSPESNPNSP 122 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 31.5 bits (68), Expect = 0.82 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 547 AXSQAPSPESNPDSP 591 A SQAPSPESNP+SP Sbjct: 52 AVSQAPSPESNPNSP 66 >SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5) Length = 203 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +1 Query: 316 CNYELXNRNNFSIRYWSWNYRGCWH 390 C + RN +RYW W R C H Sbjct: 91 CEVTVIARNILPVRYWIWLSRKCGH 115 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 28.3 bits (60), Expect = 7.7 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = -2 Query: 465 TLTRPRNRNEYTLNILTRNNWRASLXXXXXXXXXXXAYTKIVAVXKL 325 T + R ++++ R +WRASL AY K+VAV KL Sbjct: 44 TCQQTTTRVHAAMHLVIRIHWRASLVPAAAVIPAPIAYIKVVAVKKL 90 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,058,460 Number of Sequences: 59808 Number of extensions: 385957 Number of successful extensions: 817 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 728 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2215746665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -