BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0094.Seq (863 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 25 0.77 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 24 1.3 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 5.4 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 22 7.1 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 9.4 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 25.0 bits (52), Expect = 0.77 Identities = 22/71 (30%), Positives = 27/71 (38%), Gaps = 3/71 (4%) Frame = +2 Query: 563 HRXKESTL*SQGPR*QALRXQXSKCPLPTP-LRRKSLTX*KFPFPSPTLXEEKGPXFPLK 739 HR KE L G Q + S P P P L K P PT+ + FP Sbjct: 163 HRYKEEALQGDGRMRQHVMHNLSSVPQPQPVLPTYKWMQVKRNVPKPTVPKIPPAEFPTT 222 Query: 740 XPS--LKVPHP 766 S L+ P+P Sbjct: 223 SSSSALESPNP 233 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 24.2 bits (50), Expect = 1.3 Identities = 20/69 (28%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = +2 Query: 563 HRXKESTL*SQGPR*QALRXQXSKCPLPTP-LRRKSLTX*KFPFPSPTLXEEKGPXFPLK 739 HR KE L G Q + S P P P L K P PT+ + FP Sbjct: 163 HRYKEEALQGDGRMRQHVMHNLSSVPQPQPVLPTYKWMQVKRNVPKPTVPKIPPAEFPTT 222 Query: 740 XPSLKVPHP 766 S + P Sbjct: 223 SSSSALESP 231 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 585 YEVKVHVDKPYEXXVQS 635 Y+VK+ D PYE + S Sbjct: 886 YKVKLEYDGPYETSISS 902 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +2 Query: 563 HRXKESTL*SQGPR*QALRXQXSKCPLPTPL 655 HR KE L G Q + S P P P+ Sbjct: 163 HRYKEEALQGDGRMRQHVMHNLSSVPQPQPV 193 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -2 Query: 406 TGTFFTTSTVLMCSW 362 TG FFT VLM W Sbjct: 426 TGPFFTFCNVLMEMW 440 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,202 Number of Sequences: 336 Number of extensions: 2520 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23789590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -