BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0094.Seq (863 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18961| Best HMM Match : zf-U1 (HMM E-Value=0.07) 30 2.8 >SB_18961| Best HMM Match : zf-U1 (HMM E-Value=0.07) Length = 844 Score = 29.9 bits (64), Expect = 2.8 Identities = 19/62 (30%), Positives = 29/62 (46%) Frame = +2 Query: 68 AKEEKGTPKQSKRRNKTKGASMT*DLMEDIISEVAMKATAVTKAMEGTKVSASVTKKDTT 247 A +EK T + S+ K+K + + ME E + TA+ A G + V K+D T Sbjct: 402 ALKEKATAEASETPTKSKETDSS-EKMETSKEEAEQQKTAIDDASAGDEEKTEVKKEDAT 460 Query: 248 SE 253 E Sbjct: 461 VE 462 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,585,910 Number of Sequences: 59808 Number of extensions: 339121 Number of successful extensions: 844 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 835 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2467263854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -