BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0091.Seq (845 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X13585-1|CAA31926.1| 111|Homo sapiens protein ( Human mRNA for ... 82 3e-15 M26730-1|AAA60235.1| 111|Homo sapiens UQBP protein. 82 3e-15 M26700-1|AAA60236.1| 111|Homo sapiens UQBP protein. 82 3e-15 M22348-1|AAA60238.1| 111|Homo sapiens UQBP protein. 82 3e-15 CR542196-1|CAG46993.1| 111|Homo sapiens UQCRB protein. 82 3e-15 CR542176-1|CAG46973.1| 111|Homo sapiens UQCRB protein. 82 3e-15 BC041005-1|AAH41005.1| 91|Homo sapiens UQCRB protein protein. 82 3e-15 BC005230-1|AAH05230.1| 111|Homo sapiens ubiquinol-cytochrome c ... 82 3e-15 BX640896-1|CAE45944.1| 1359|Homo sapiens hypothetical protein pr... 32 3.0 BX537759-1|CAD97828.1| 1763|Homo sapiens hypothetical protein pr... 32 3.0 BX537708-1|CAD97819.1| 1605|Homo sapiens hypothetical protein pr... 32 3.0 BC146782-1|AAI46783.1| 1814|Homo sapiens CDK5 regulatory subunit... 32 3.0 AL590642-1|CAH70769.1| 1893|Homo sapiens CDK5 regulatory subunit... 32 3.0 AL391870-3|CAI40927.1| 1287|Homo sapiens CDK5 regulatory subunit... 32 3.0 AL391870-1|CAI40925.1| 1893|Homo sapiens CDK5 regulatory subunit... 32 3.0 AL353736-5|CAI40657.1| 903|Homo sapiens CDK5 regulatory subunit... 32 3.0 AL353736-4|CAI40656.1| 400|Homo sapiens CDK5 regulatory subunit... 32 3.0 AL353736-3|CAI40655.1| 1287|Homo sapiens CDK5 regulatory subunit... 32 3.0 AL353736-1|CAI40653.1| 1893|Homo sapiens CDK5 regulatory subunit... 32 3.0 AL138836-1|CAI16963.1| 1893|Homo sapiens CDK5 regulatory subunit... 32 3.0 AL133161-1|CAB61487.1| 1287|Homo sapiens hypothetical protein pr... 32 3.0 AK027636-1|BAB55253.1| 943|Homo sapiens protein ( Homo sapiens ... 32 3.0 AF448860-1|AAP41926.1| 1893|Homo sapiens hypothetical protein pr... 32 3.0 AB046853-1|BAB13459.2| 1852|Homo sapiens KIAA1633 protein protein. 32 3.0 U06469-1|AAA53215.1| 524|Homo sapiens HEAAC1 protein. 31 6.9 M60298-1|AAA74589.1| 721|Homo sapiens erythrocyte membrane prot... 31 6.9 M30647-1|AAA36401.1| 721|Homo sapiens protein ( Human erythrocy... 31 6.9 M30646-1|AAA36402.1| 691|Homo sapiens protein ( Human erythrocy... 31 6.9 M29399-1|AAA35798.1| 691|Homo sapiens protein ( Human erythrocy... 31 6.9 L06519-1|AAA52385.1| 721|Homo sapiens protein ( Human erythrocy... 31 6.9 CR533537-1|CAG38568.1| 463|Homo sapiens UBE1C protein. 31 6.9 BC099627-1|AAH99627.1| 619|Homo sapiens EPB42 protein protein. 31 6.9 BC096095-1|AAH96095.1| 358|Homo sapiens EPB42 protein protein. 31 6.9 BC096094-1|AAH96094.1| 691|Homo sapiens EPB42 protein protein. 31 6.9 BC096093-1|AAH96093.1| 691|Homo sapiens EPB42 protein protein. 31 6.9 BC022853-1|AAH22853.1| 463|Homo sapiens ubiquitin-activating en... 31 6.9 AF046024-1|AAC27648.1| 442|Homo sapiens UBA3 protein. 31 6.9 AB012190-1|BAA33144.1| 442|Homo sapiens Nedd8-activating enzyme... 31 6.9 AK001729-1|BAA91865.1| 902|Homo sapiens protein ( Homo sapiens ... 30 9.2 >X13585-1|CAA31926.1| 111|Homo sapiens protein ( Human mRNA for mitochondrial ubiquinone-binding protein (QP-C). ). Length = 111 Score = 81.8 bits (193), Expect = 3e-15 Identities = 33/65 (50%), Positives = 52/65 (80%) Frame = -1 Query: 257 SLRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLERE 78 ++RRLP ++ ++R FRI RA+ L+++ ILPKE+WTKYEE++ YL P +++V +ER ERE Sbjct: 47 AIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKERE 106 Query: 77 QWEKE 63 +W K+ Sbjct: 107 EWAKK 111 Score = 48.0 bits (109), Expect = 4e-05 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -2 Query: 352 DSLSKWAYNLSGFNKYGLLRDDCLHETPDVTEA 254 D + KW YN +GFNK GL+RDD ++E DV EA Sbjct: 15 DGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEA 47 >M26730-1|AAA60235.1| 111|Homo sapiens UQBP protein. Length = 111 Score = 81.8 bits (193), Expect = 3e-15 Identities = 33/65 (50%), Positives = 52/65 (80%) Frame = -1 Query: 257 SLRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLERE 78 ++RRLP ++ ++R FRI RA+ L+++ ILPKE+WTKYEE++ YL P +++V +ER ERE Sbjct: 47 AIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKERE 106 Query: 77 QWEKE 63 +W K+ Sbjct: 107 EWAKK 111 Score = 48.0 bits (109), Expect = 4e-05 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -2 Query: 352 DSLSKWAYNLSGFNKYGLLRDDCLHETPDVTEA 254 D + KW YN +GFNK GL+RDD ++E DV EA Sbjct: 15 DGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEA 47 >M26700-1|AAA60236.1| 111|Homo sapiens UQBP protein. Length = 111 Score = 81.8 bits (193), Expect = 3e-15 Identities = 33/65 (50%), Positives = 52/65 (80%) Frame = -1 Query: 257 SLRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLERE 78 ++RRLP ++ ++R FRI RA+ L+++ ILPKE+WTKYEE++ YL P +++V +ER ERE Sbjct: 47 AIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKERE 106 Query: 77 QWEKE 63 +W K+ Sbjct: 107 EWAKK 111 Score = 48.0 bits (109), Expect = 4e-05 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -2 Query: 352 DSLSKWAYNLSGFNKYGLLRDDCLHETPDVTEA 254 D + KW YN +GFNK GL+RDD ++E DV EA Sbjct: 15 DGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEA 47 >M22348-1|AAA60238.1| 111|Homo sapiens UQBP protein. Length = 111 Score = 81.8 bits (193), Expect = 3e-15 Identities = 33/65 (50%), Positives = 52/65 (80%) Frame = -1 Query: 257 SLRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLERE 78 ++RRLP ++ ++R FRI RA+ L+++ ILPKE+WTKYEE++ YL P +++V +ER ERE Sbjct: 47 AIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKERE 106 Query: 77 QWEKE 63 +W K+ Sbjct: 107 EWAKK 111 Score = 48.0 bits (109), Expect = 4e-05 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -2 Query: 352 DSLSKWAYNLSGFNKYGLLRDDCLHETPDVTEA 254 D + KW YN +GFNK GL+RDD ++E DV EA Sbjct: 15 DGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEA 47 >CR542196-1|CAG46993.1| 111|Homo sapiens UQCRB protein. Length = 111 Score = 81.8 bits (193), Expect = 3e-15 Identities = 33/65 (50%), Positives = 52/65 (80%) Frame = -1 Query: 257 SLRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLERE 78 ++RRLP ++ ++R FRI RA+ L+++ ILPKE+WTKYEE++ YL P +++V +ER ERE Sbjct: 47 AIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKERE 106 Query: 77 QWEKE 63 +W K+ Sbjct: 107 EWAKK 111 Score = 48.0 bits (109), Expect = 4e-05 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -2 Query: 352 DSLSKWAYNLSGFNKYGLLRDDCLHETPDVTEA 254 D + KW YN +GFNK GL+RDD ++E DV EA Sbjct: 15 DGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEA 47 >CR542176-1|CAG46973.1| 111|Homo sapiens UQCRB protein. Length = 111 Score = 81.8 bits (193), Expect = 3e-15 Identities = 33/65 (50%), Positives = 52/65 (80%) Frame = -1 Query: 257 SLRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLERE 78 ++RRLP ++ ++R FRI RA+ L+++ ILPKE+WTKYEE++ YL P +++V +ER ERE Sbjct: 47 AIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKERE 106 Query: 77 QWEKE 63 +W K+ Sbjct: 107 EWAKK 111 Score = 48.0 bits (109), Expect = 4e-05 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -2 Query: 352 DSLSKWAYNLSGFNKYGLLRDDCLHETPDVTEA 254 D + KW YN +GFNK GL+RDD ++E DV EA Sbjct: 15 DGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEA 47 >BC041005-1|AAH41005.1| 91|Homo sapiens UQCRB protein protein. Length = 91 Score = 81.8 bits (193), Expect = 3e-15 Identities = 33/65 (50%), Positives = 52/65 (80%) Frame = -1 Query: 257 SLRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLERE 78 ++RRLP ++ ++R FRI RA+ L+++ ILPKE+WTKYEE++ YL P +++V +ER ERE Sbjct: 27 AIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKERE 86 Query: 77 QWEKE 63 +W K+ Sbjct: 87 EWAKK 91 >BC005230-1|AAH05230.1| 111|Homo sapiens ubiquinol-cytochrome c reductase binding protein protein. Length = 111 Score = 81.8 bits (193), Expect = 3e-15 Identities = 33/65 (50%), Positives = 52/65 (80%) Frame = -1 Query: 257 SLRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLERE 78 ++RRLP ++ ++R FRI RA+ L+++ ILPKE+WTKYEE++ YL P +++V +ER ERE Sbjct: 47 AIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKERE 106 Query: 77 QWEKE 63 +W K+ Sbjct: 107 EWAKK 111 Score = 48.0 bits (109), Expect = 4e-05 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -2 Query: 352 DSLSKWAYNLSGFNKYGLLRDDCLHETPDVTEA 254 D + KW YN +GFNK GL+RDD ++E DV EA Sbjct: 15 DGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEA 47 >BX640896-1|CAE45944.1| 1359|Homo sapiens hypothetical protein protein. Length = 1359 Score = 31.9 bits (69), Expect = 3.0 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 338 FAEAVTSVNSRGSESHHGSCSKSHFIDSQIYDFNVILTQTTRNSQ 472 F + TS+ + GSE H S+ HF+ Q N +L + +R+ Q Sbjct: 1199 FVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQ 1243 >BX537759-1|CAD97828.1| 1763|Homo sapiens hypothetical protein protein. Length = 1763 Score = 31.9 bits (69), Expect = 3.0 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 338 FAEAVTSVNSRGSESHHGSCSKSHFIDSQIYDFNVILTQTTRNSQ 472 F + TS+ + GSE H S+ HF+ Q N +L + +R+ Q Sbjct: 1430 FVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQ 1474 >BX537708-1|CAD97819.1| 1605|Homo sapiens hypothetical protein protein. Length = 1605 Score = 31.9 bits (69), Expect = 3.0 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 338 FAEAVTSVNSRGSESHHGSCSKSHFIDSQIYDFNVILTQTTRNSQ 472 F + TS+ + GSE H S+ HF+ Q N +L + +R+ Q Sbjct: 1200 FVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQ 1244 >BC146782-1|AAI46783.1| 1814|Homo sapiens CDK5 regulatory subunit associated protein 2 protein. Length = 1814 Score = 31.9 bits (69), Expect = 3.0 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 338 FAEAVTSVNSRGSESHHGSCSKSHFIDSQIYDFNVILTQTTRNSQ 472 F + TS+ + GSE H S+ HF+ Q N +L + +R+ Q Sbjct: 1430 FVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQ 1474 >AL590642-1|CAH70769.1| 1893|Homo sapiens CDK5 regulatory subunit associated protein 2 protein. Length = 1893 Score = 31.9 bits (69), Expect = 3.0 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 338 FAEAVTSVNSRGSESHHGSCSKSHFIDSQIYDFNVILTQTTRNSQ 472 F + TS+ + GSE H S+ HF+ Q N +L + +R+ Q Sbjct: 1430 FVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQ 1474 >AL391870-3|CAI40927.1| 1287|Homo sapiens CDK5 regulatory subunit associated protein 2 protein. Length = 1287 Score = 31.9 bits (69), Expect = 3.0 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 338 FAEAVTSVNSRGSESHHGSCSKSHFIDSQIYDFNVILTQTTRNSQ 472 F + TS+ + GSE H S+ HF+ Q N +L + +R+ Q Sbjct: 824 FVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQ 868 >AL391870-1|CAI40925.1| 1893|Homo sapiens CDK5 regulatory subunit associated protein 2 protein. Length = 1893 Score = 31.9 bits (69), Expect = 3.0 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 338 FAEAVTSVNSRGSESHHGSCSKSHFIDSQIYDFNVILTQTTRNSQ 472 F + TS+ + GSE H S+ HF+ Q N +L + +R+ Q Sbjct: 1430 FVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQ 1474 >AL353736-5|CAI40657.1| 903|Homo sapiens CDK5 regulatory subunit associated protein 2 protein. Length = 903 Score = 31.9 bits (69), Expect = 3.0 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 338 FAEAVTSVNSRGSESHHGSCSKSHFIDSQIYDFNVILTQTTRNSQ 472 F + TS+ + GSE H S+ HF+ Q N +L + +R+ Q Sbjct: 440 FVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQ 484 >AL353736-4|CAI40656.1| 400|Homo sapiens CDK5 regulatory subunit associated protein 2 protein. Length = 400 Score = 31.9 bits (69), Expect = 3.0 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 338 FAEAVTSVNSRGSESHHGSCSKSHFIDSQIYDFNVILTQTTRNSQ 472 F + TS+ + GSE H S+ HF+ Q N +L + +R+ Q Sbjct: 16 FVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQ 60 >AL353736-3|CAI40655.1| 1287|Homo sapiens CDK5 regulatory subunit associated protein 2 protein. Length = 1287 Score = 31.9 bits (69), Expect = 3.0 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 338 FAEAVTSVNSRGSESHHGSCSKSHFIDSQIYDFNVILTQTTRNSQ 472 F + TS+ + GSE H S+ HF+ Q N +L + +R+ Q Sbjct: 824 FVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQ 868 >AL353736-1|CAI40653.1| 1893|Homo sapiens CDK5 regulatory subunit associated protein 2 protein. Length = 1893 Score = 31.9 bits (69), Expect = 3.0 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 338 FAEAVTSVNSRGSESHHGSCSKSHFIDSQIYDFNVILTQTTRNSQ 472 F + TS+ + GSE H S+ HF+ Q N +L + +R+ Q Sbjct: 1430 FVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQ 1474 >AL138836-1|CAI16963.1| 1893|Homo sapiens CDK5 regulatory subunit associated protein 2 protein. Length = 1893 Score = 31.9 bits (69), Expect = 3.0 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 338 FAEAVTSVNSRGSESHHGSCSKSHFIDSQIYDFNVILTQTTRNSQ 472 F + TS+ + GSE H S+ HF+ Q N +L + +R+ Q Sbjct: 1430 FVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQ 1474 >AL133161-1|CAB61487.1| 1287|Homo sapiens hypothetical protein protein. Length = 1287 Score = 31.9 bits (69), Expect = 3.0 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 338 FAEAVTSVNSRGSESHHGSCSKSHFIDSQIYDFNVILTQTTRNSQ 472 F + TS+ + GSE H S+ HF+ Q N +L + +R+ Q Sbjct: 824 FVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQ 868 >AK027636-1|BAB55253.1| 943|Homo sapiens protein ( Homo sapiens cDNA FLJ14730 fis, clone NT2RP3001931, weakly similar to Rattus norvegicus clone C48 CDK5 activator-binding protein mRNA. ). Length = 943 Score = 31.9 bits (69), Expect = 3.0 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 338 FAEAVTSVNSRGSESHHGSCSKSHFIDSQIYDFNVILTQTTRNSQ 472 F + TS+ + GSE H S+ HF+ Q N +L + +R+ Q Sbjct: 480 FVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQ 524 >AF448860-1|AAP41926.1| 1893|Homo sapiens hypothetical protein protein. Length = 1893 Score = 31.9 bits (69), Expect = 3.0 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 338 FAEAVTSVNSRGSESHHGSCSKSHFIDSQIYDFNVILTQTTRNSQ 472 F + TS+ + GSE H S+ HF+ Q N +L + +R+ Q Sbjct: 1430 FVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQ 1474 >AB046853-1|BAB13459.2| 1852|Homo sapiens KIAA1633 protein protein. Length = 1852 Score = 31.9 bits (69), Expect = 3.0 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 338 FAEAVTSVNSRGSESHHGSCSKSHFIDSQIYDFNVILTQTTRNSQ 472 F + TS+ + GSE H S+ HF+ Q N +L + +R+ Q Sbjct: 1468 FVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQ 1512 >U06469-1|AAA53215.1| 524|Homo sapiens HEAAC1 protein. Length = 524 Score = 30.7 bits (66), Expect = 6.9 Identities = 33/129 (25%), Positives = 49/129 (37%), Gaps = 6/129 (4%) Frame = -2 Query: 802 LSVSVXVARQFYFDQLECSKAG*KCCLEYFVHGIIEYDLGSILLVFRTPXXXXXXXXXXX 623 L +S + D K G + L YF +I LG +L+V P Sbjct: 70 LIISSMITGVAALDSNVSGKIGLRAVLYYFCTTLIAVILGIVLVVSIKPGVTQKVGEIAR 129 Query: 622 XXXXLEVK----FLDRRKTNISESICQRCFHQSRTK-VRGSKALDTALVLTVNMSLAI-S 461 EV LD + E++ Q CF Q +TK + A D + +T A+ + Sbjct: 130 TGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVNPASDPEMNMTEESFTAVMT 189 Query: 460 GCLSKNYVK 434 +SKN K Sbjct: 190 TAISKNKTK 198 >M60298-1|AAA74589.1| 721|Homo sapiens erythrocyte membrane protein protein. Length = 721 Score = 30.7 bits (66), Expect = 6.9 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 149 KYEEDSLYLTPIVEQVEKERLEREQ 75 KY E SL ++E+VEKE++ERE+ Sbjct: 466 KYPEGSLQEKEVLERVEKEKMEREK 490 >M30647-1|AAA36401.1| 721|Homo sapiens protein ( Human erythrocyte membrane protein 4.2 (P4.2L) mRNA, complete cds. ). Length = 721 Score = 30.7 bits (66), Expect = 6.9 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 149 KYEEDSLYLTPIVEQVEKERLEREQ 75 KY E SL ++E+VEKE++ERE+ Sbjct: 466 KYPEGSLQEKEVLERVEKEKMEREK 490 >M30646-1|AAA36402.1| 691|Homo sapiens protein ( Human erythrocyte membrane protein 4.2 (P4.2S) mRNA, complete cds. ). Length = 691 Score = 30.7 bits (66), Expect = 6.9 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 149 KYEEDSLYLTPIVEQVEKERLEREQ 75 KY E SL ++E+VEKE++ERE+ Sbjct: 436 KYPEGSLQEKEVLERVEKEKMEREK 460 >M29399-1|AAA35798.1| 691|Homo sapiens protein ( Human erythrocyte membrane protein band 4.2 mRNA, complete cds. ). Length = 691 Score = 30.7 bits (66), Expect = 6.9 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 149 KYEEDSLYLTPIVEQVEKERLEREQ 75 KY E SL ++E+VEKE++ERE+ Sbjct: 436 KYPEGSLQEKEVLERVEKEKMEREK 460 >L06519-1|AAA52385.1| 721|Homo sapiens protein ( Human erythrocyte membrane protein band 4.2 gene, exon 13. ). Length = 721 Score = 30.7 bits (66), Expect = 6.9 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 149 KYEEDSLYLTPIVEQVEKERLEREQ 75 KY E SL ++E+VEKE++ERE+ Sbjct: 466 KYPEGSLQEKEVLERVEKEKMEREK 490 >CR533537-1|CAG38568.1| 463|Homo sapiens UBE1C protein. Length = 463 Score = 30.7 bits (66), Expect = 6.9 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -3 Query: 324 FRDSINMVCYGMIACMKLLM*LKPPQTSIPCC*REKLP 211 F+ + ++ GM AC++ + L PPQ + P C +P Sbjct: 206 FKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMP 243 >BC099627-1|AAH99627.1| 619|Homo sapiens EPB42 protein protein. Length = 619 Score = 30.7 bits (66), Expect = 6.9 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 149 KYEEDSLYLTPIVEQVEKERLEREQ 75 KY E SL ++E+VEKE++ERE+ Sbjct: 364 KYPEGSLQEKEVLERVEKEKMEREK 388 >BC096095-1|AAH96095.1| 358|Homo sapiens EPB42 protein protein. Length = 358 Score = 30.7 bits (66), Expect = 6.9 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 149 KYEEDSLYLTPIVEQVEKERLEREQ 75 KY E SL ++E+VEKE++ERE+ Sbjct: 103 KYPEGSLQEKEVLERVEKEKMEREK 127 >BC096094-1|AAH96094.1| 691|Homo sapiens EPB42 protein protein. Length = 691 Score = 30.7 bits (66), Expect = 6.9 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 149 KYEEDSLYLTPIVEQVEKERLEREQ 75 KY E SL ++E+VEKE++ERE+ Sbjct: 436 KYPEGSLQEKEVLERVEKEKMEREK 460 >BC096093-1|AAH96093.1| 691|Homo sapiens EPB42 protein protein. Length = 691 Score = 30.7 bits (66), Expect = 6.9 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 149 KYEEDSLYLTPIVEQVEKERLEREQ 75 KY E SL ++E+VEKE++ERE+ Sbjct: 436 KYPEGSLQEKEVLERVEKEKMEREK 460 >BC022853-1|AAH22853.1| 463|Homo sapiens ubiquitin-activating enzyme E1C (UBA3 homolog, yeast) protein. Length = 463 Score = 30.7 bits (66), Expect = 6.9 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -3 Query: 324 FRDSINMVCYGMIACMKLLM*LKPPQTSIPCC*REKLP 211 F+ + ++ GM AC++ + L PPQ + P C +P Sbjct: 206 FKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMP 243 >AF046024-1|AAC27648.1| 442|Homo sapiens UBA3 protein. Length = 442 Score = 30.7 bits (66), Expect = 6.9 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -3 Query: 324 FRDSINMVCYGMIACMKLLM*LKPPQTSIPCC*REKLP 211 F+ + ++ GM AC++ + L PPQ + P C +P Sbjct: 185 FKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMP 222 >AB012190-1|BAA33144.1| 442|Homo sapiens Nedd8-activating enzyme hUba3 protein. Length = 442 Score = 30.7 bits (66), Expect = 6.9 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -3 Query: 324 FRDSINMVCYGMIACMKLLM*LKPPQTSIPCC*REKLP 211 F+ + ++ GM AC++ + L PPQ + P C +P Sbjct: 185 FKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMP 222 >AK001729-1|BAA91865.1| 902|Homo sapiens protein ( Homo sapiens cDNA FLJ10867 fis, clone NT2RP4001634. ). Length = 902 Score = 30.3 bits (65), Expect = 9.2 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +2 Query: 338 FAEAVTSVNSRGSESHHGSCSKSHFIDSQIYDFNVILTQTTRNSQ 472 F + TS+ + GSE H S+ HF+ + N +L + +R+ Q Sbjct: 439 FVQGSTSIFASGSELHSSLTSEIHFLRKRNQALNAMLIKGSRDKQ 483 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,556,715 Number of Sequences: 237096 Number of extensions: 2279643 Number of successful extensions: 4909 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 4575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4886 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10705443456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -