BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0090.Seq (861 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 25 1.0 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 24 1.3 AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 22 5.4 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 22 7.2 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 24.6 bits (51), Expect = 1.0 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 337 SAGDPPGGARYPIRPIVSRITIHWPSFY 420 S G PP G YP P R+ I +Y Sbjct: 70 SGGQPPQGMPYPRFPPYDRMDIRAAGYY 97 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 104 SPRPSVATGLAPSTGKRPRSRRTWTG 181 +P P+ G P PRS+R +TG Sbjct: 262 APSPTAGAGGLPPQVPSPRSQRRYTG 287 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 22.2 bits (45), Expect = 5.4 Identities = 20/66 (30%), Positives = 22/66 (33%) Frame = +1 Query: 67 SLSSNPTLRSVPLAATLRRYGPGTLYGKTAPFKTNLDRSRRDEKAEPPEHHISRYRLKQR 246 S PT P L YG G Y A K S KA EH + Y K Sbjct: 57 SAGLQPTTGYYPYDPALAAYGYGAGYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGE 116 Query: 247 DSVWAI 264 + AI Sbjct: 117 KIMLAI 122 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.8 bits (44), Expect = 7.2 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +1 Query: 481 LSPAGVIAKSPHRSPFPTVAQLNGEWQIVSV 573 LSP+G SP+P L+G + S+ Sbjct: 58 LSPSGNTPNKSSTSPYPPNHPLSGSKHLCSI 88 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,873 Number of Sequences: 336 Number of extensions: 4160 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23866870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -