BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0090.Seq (861 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 25 2.2 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 25 2.2 DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 25 3.9 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 24 5.2 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 24 6.8 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 24 6.8 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 24 6.8 AJ618920-1|CAF01999.1| 204|Anopheles gambiae putative odorant-b... 23 9.0 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 25.4 bits (53), Expect = 2.2 Identities = 19/64 (29%), Positives = 29/64 (45%) Frame = +2 Query: 128 GLAPSTGKRPRSRRTWTGVVATRKRNLPNTTSPVID*NNGIQSGLYSCSLAATKEILVSF 307 G P ++ R W GV+ KR P S ++D GL + +LAAT + + Sbjct: 406 GKKPPNNPLEKTNRLWGGVINDIKRRYPMYKSDIMD-------GLNTEALAATIFMYFAA 458 Query: 308 FSSA 319 S+A Sbjct: 459 LSTA 462 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 25.4 bits (53), Expect = 2.2 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 438 NPGVTQLNRLAAHPPFASWRNSEEPAPIALPNSCAA 545 +PG +L+ HPP AS R+S P + + AA Sbjct: 835 HPGAQTQPQLSQHPPGASGRSSAVITPPSTHHQAAA 870 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 24.6 bits (51), Expect = 3.9 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 104 SPRPSVATGLAPSTGKRPRSRRTWTGVVATRKRNLP 211 +P S++ G++ P + WTG V RK+ P Sbjct: 241 NPGSSLSVGVSGVGSCTPSNPLEWTGNVTVRKKRKP 276 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 24.2 bits (50), Expect = 5.2 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -3 Query: 379 GELGTGPPREDHPPNLSILVSGGKETNQ 296 G L PP PP VSGG++ NQ Sbjct: 232 GALPETPPPAYSPPEEGNTVSGGQDGNQ 259 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.8 bits (49), Expect = 6.8 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +2 Query: 113 PSVATGLAPSTGKRPRSRRTWTGVVATRKRNLPNTTSPVID 235 P + P + PR WTGV+ T PN+ ++D Sbjct: 195 PYAQPPVGPLRFRHPRPAEKWTGVLNT--TTPPNSCVQIVD 233 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.8 bits (49), Expect = 6.8 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +2 Query: 113 PSVATGLAPSTGKRPRSRRTWTGVVATRKRNLPNTTSPVID 235 P + P + PR WTGV+ T PN+ ++D Sbjct: 195 PYAQPPVGPLRFRHPRPAEKWTGVLNT--TTPPNSCVQIVD 233 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 23.8 bits (49), Expect = 6.8 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +2 Query: 113 PSVATGLAPSTGKRPRSRRTWTGVVATRKRNLPNTTSPVID 235 P + P + PR WTGV+ T PN+ ++D Sbjct: 81 PYAQPPVGPLRFRHPRPAEKWTGVLNT--TTPPNSCVQIVD 119 >AJ618920-1|CAF01999.1| 204|Anopheles gambiae putative odorant-binding protein OBPjj4 protein. Length = 204 Score = 23.4 bits (48), Expect = 9.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 468 AAHPPFASWRNSEEPAPIALPNSCAAE 548 AAHP F +N+++ P P C AE Sbjct: 59 AAHP-FKPPQNTDDKGPRGHPGECIAE 84 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 835,589 Number of Sequences: 2352 Number of extensions: 17950 Number of successful extensions: 34 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 91786122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -