BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0090.Seq (861 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78061-1|CAB01494.1| 658|Caenorhabditis elegans Hypothetical pr... 28 7.4 AC006833-9|AAF60943.1| 318|Caenorhabditis elegans Saposin-like ... 28 7.4 >Z78061-1|CAB01494.1| 658|Caenorhabditis elegans Hypothetical protein C48G7.1 protein. Length = 658 Score = 28.3 bits (60), Expect = 7.4 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +1 Query: 61 GLSLSSNPTLRSVPLAATLRRYGPGTL-YGKTAPFKTNLDR-SRRDEKAEPPEHHISR 228 G S +S+P+ RS PLA R G + G K+N R + +E + P H I R Sbjct: 392 GSSATSSPSSRSRPLAMRRERSDIGVISNGMNLGVKSNAQRLAYHNESSPGPAHAIGR 449 >AC006833-9|AAF60943.1| 318|Caenorhabditis elegans Saposin-like protein family protein7 protein. Length = 318 Score = 28.3 bits (60), Expect = 7.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 708 WNKSPLLKERGXPTSXGEKPS 770 WN+ P+++ER P+ G PS Sbjct: 24 WNEEPVVRERASPSPNGNTPS 44 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,519,799 Number of Sequences: 27780 Number of extensions: 393725 Number of successful extensions: 991 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 947 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 991 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2150453690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -