BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0090.Seq (861 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03680.1 68416.m00371 C2 domain-containing protein contains I... 34 0.11 At2g12505.1 68415.m01352 hypothetical protein 32 0.56 At3g51540.1 68416.m05644 expressed protein mucin 5AC, Homo sapie... 29 3.0 At3g47230.1 68416.m05128 expressed protein 29 4.0 At4g08880.1 68417.m01464 Ulp1 protease family protein contains P... 28 7.0 At3g13360.1 68416.m01681 expressed protein 28 7.0 At1g15290.1 68414.m01830 tetratricopeptide repeat (TPR)-containi... 28 7.0 >At3g03680.1 68416.m00371 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1017 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/70 (27%), Positives = 37/70 (52%) Frame = -2 Query: 647 ADFGPNWLKNELI*QKFNANFNKILTLTICHSPFSCATVGKGDRCGLFAITPAGERGMCC 468 A +GP W++ I +FN +N+ T + + P + T+G D G + +G++G Sbjct: 635 AKYGPKWIRTRTILDRFNPRWNEQYTWDV-YDPCTVLTIGVFDN-GRYKRDESGKQG--- 689 Query: 467 KAIKLGNARV 438 + +++G RV Sbjct: 690 RDVRVGKIRV 699 >At2g12505.1 68415.m01352 hypothetical protein Length = 344 Score = 31.9 bits (69), Expect = 0.56 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 8/73 (10%) Frame = +1 Query: 370 PIRPIVSRITIHWPSFYNV-VTGKTLALPNLIALQHIPLSPAG------VIAKSPHRSPF 528 PIRP + + S Y + KT LP+ + H + P G V SP R+PF Sbjct: 183 PIRPTIGQADPIRRSVYQIRFVPKTNGLPSPFSTLHRTVGPGGSMRISSVELYSPSRTPF 242 Query: 529 PT-VAQLNGEWQI 564 PT ++ GEW + Sbjct: 243 PTNNFRMWGEWML 255 >At3g51540.1 68416.m05644 expressed protein mucin 5AC, Homo sapiens, PIR:S53363 Length = 438 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/60 (26%), Positives = 27/60 (45%) Frame = +1 Query: 49 TTRLGLSLSSNPTLRSVPLAATLRRYGPGTLYGKTAPFKTNLDRSRRDEKAEPPEHHISR 228 TTR+ L S+P+ R +T+R T+ + P KT + + P+ +SR Sbjct: 98 TTRVPLRSESDPSSRPTRSGSTIRPSNIPTIRSSSVPKKTTTTQIQASASVSSPKRTVSR 157 >At3g47230.1 68416.m05128 expressed protein Length = 277 Score = 29.1 bits (62), Expect = 4.0 Identities = 23/69 (33%), Positives = 29/69 (42%), Gaps = 7/69 (10%) Frame = +1 Query: 349 PPGGARYPIRPIVSRITIHWPSFYNV-VTGKTLALPNLIALQHIPLSPAG------VIAK 507 P G PIRP + S Y + KT LP+ + H + P G V Sbjct: 29 PTIGLADPIRPTIGLADPIRRSVYQIRFVSKTNGLPSPSSTLHRTVGPGGSMRISSVELY 88 Query: 508 SPHRSPFPT 534 SP R+PFPT Sbjct: 89 SPSRTPFPT 97 >At4g08880.1 68417.m01464 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300 Length = 1463 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +2 Query: 104 SPRPSVATGLAPSTGKRPRSRRTWTGVVATRKRNLPNTTSPVID 235 S P + AP TGK+P R + G TRK + S +D Sbjct: 376 SREPPTSMDKAPVTGKKPSRRMSTKGSTGTRKSSRLTRVSHDVD 419 >At3g13360.1 68416.m01681 expressed protein Length = 459 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +3 Query: 42 GVYHPLRAVTLKQPDSKERPSRRDPPSLRAWHPLRENGPVQDE 170 GV P R+ +++ P +R+ L+ W ++ +GPV+DE Sbjct: 33 GVGSPQRSNSVESPGGSVHSTRKGF-GLKKWRRIKRDGPVRDE 74 >At1g15290.1 68414.m01830 tetratricopeptide repeat (TPR)-containing protein ESTs gb|F20110 and gb|F20109 come from this gene; contains Pfam profile PF00515: TPR Domain Length = 1558 Score = 28.3 bits (60), Expect = 7.0 Identities = 22/81 (27%), Positives = 31/81 (38%) Frame = +1 Query: 211 EHHISRYRLKQRDSVWAIFLFARRY*GNPG*FLFLRLLICLNSAGDPPGGARYPIRPIVS 390 E + YR K+ + L A NPG FL + L + G P PI V Sbjct: 1337 EGDLGSYRGKKTSDISRTKLSASAEPYNPGGFLVIDLQSSAATIGSYPIMVADPISWAVV 1396 Query: 391 RITIHWPSFYNVVTGKTLALP 453 IH P +Y+ + + P Sbjct: 1397 SCGIHSPPYYSAIHSNGVGTP 1417 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,857,300 Number of Sequences: 28952 Number of extensions: 378694 Number of successful extensions: 917 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 917 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2009406400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -