BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0089.Seq (687 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81576-5|CAB04646.2| 1696|Caenorhabditis elegans Hypothetical pr... 28 7.2 AF038611-7|AAB92040.1| 466|Caenorhabditis elegans Hypothetical ... 28 7.2 >Z81576-5|CAB04646.2| 1696|Caenorhabditis elegans Hypothetical protein R10E8.6 protein. Length = 1696 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/66 (21%), Positives = 27/66 (40%) Frame = -2 Query: 320 TFYTSATSHYIRSSQXFHXPLCSAPALFLXSRSDPVGAEPSNRSVHDSWCSMGIKCTWKC 141 T Y ++ Y + + + +AP D G E R++ + C+ +K + K Sbjct: 501 TDYITSVLSYFQPGTLENIAIHTAPHTIAMELEDIAGLEQWKRAISVAMCNTTLKLSSKS 560 Query: 140 WDKSPH 123 W+ H Sbjct: 561 WENFKH 566 >AF038611-7|AAB92040.1| 466|Caenorhabditis elegans Hypothetical protein E04A4.6 protein. Length = 466 Score = 27.9 bits (59), Expect = 7.2 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +3 Query: 561 DTANGSIYQFWFLRSYSVTWITVVILELIHAIRTL 665 D+ G++ WF +++SV WI +V+ I +T+ Sbjct: 224 DSLPGNVDNNWFEQTFSVYWIPLVVASEIETNQTV 258 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,540,819 Number of Sequences: 27780 Number of extensions: 227650 Number of successful extensions: 579 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1571291122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -