BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0085.Seq (786 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_53881| Best HMM Match : LSPR (HMM E-Value=1.7) 28 9.9 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 141 KKLKDLKWETVPLEGFPASVTDKLQGFVGLEECTSYGLTGK 263 K+ + KW +V LE P+ + ++GFV LEE Y L K Sbjct: 6 KRNRKRKWRSVALEN-PSFFSGDMEGFVSLEELNDYTLEKK 45 >SB_53881| Best HMM Match : LSPR (HMM E-Value=1.7) Length = 331 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Frame = +2 Query: 488 QDIGALL--LV*EFI*QRSFAXYQII*IFILLVVKCPC 595 ++I ALL LV E+ QRSFA + + +F+LL C C Sbjct: 233 KNIEALLTYLVEEYKFQRSFATTEFVCLFLLLFHTCMC 270 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,927,629 Number of Sequences: 59808 Number of extensions: 293708 Number of successful extensions: 436 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 436 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -