BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0084.Seq (822 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ304410-1|CAC67443.1| 190|Anopheles gambiae calpain protein. 27 0.70 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 26 1.2 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 24 6.5 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 24 6.5 >AJ304410-1|CAC67443.1| 190|Anopheles gambiae calpain protein. Length = 190 Score = 27.1 bits (57), Expect = 0.70 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = +2 Query: 512 VCKVSSDAHKQVMLYAXQVEWNTNASLYFWIIVTVLGGCRH 634 +C +S D+ + ++ W + W + T GGCR+ Sbjct: 66 ICNLSPDSLSDDEMTRGKISWEMSMFEGEWAVGTTAGGCRN 106 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 26.2 bits (55), Expect = 1.2 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +2 Query: 494 NCCNAYVCKVSSDAHKQVMLYAXQVEWNTN 583 +CC+ Y C + KQ Y Q W++N Sbjct: 745 HCCDFYACDCKMECPKQCTCYHDQ-SWSSN 773 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.8 bits (49), Expect = 6.5 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = +1 Query: 463 QNCALSKRQRKLL*CVCMQSLI*RTQTGDVVREXGRMEYQCESIFLDH 606 QNCA+ ++ KLL + + + + + R ++E Q E + H Sbjct: 130 QNCAMKEQNAKLLEQITGMCQLLQEEKEEAKRREEKLEAQMEKLAAAH 177 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 23.8 bits (49), Expect = 6.5 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 399 EAIFNGIDEFNVDNESLFPIIAELRVIKTPEEIA 500 +A+ G EF+ + L P +AEL +K P +A Sbjct: 120 DAMTLGNHEFDHSPKGLAPYLAELEKMKIPTVVA 153 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 912,960 Number of Sequences: 2352 Number of extensions: 19195 Number of successful extensions: 55 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87318630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -