Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ps4M0079.Seq
         (814 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U58757-2|AAC47915.2|  402|Caenorhabditis elegans Hypothetical pr...    31   1.3  

>U58757-2|AAC47915.2|  402|Caenorhabditis elegans Hypothetical
           protein C01B10.3 protein.
          Length = 402

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = +1

Query: 13  SSAVMCQCLAVTERFYTIFRGAESFYSTKLESFSSLELYK 132
           ++ V+C C+      Y  F  + +F+ TKL    +L L+K
Sbjct: 59  AARVICGCITDNPEIYRAFDSSMAFFDTKLTGLGNLYLFK 98


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,959,374
Number of Sequences: 27780
Number of extensions: 266089
Number of successful extensions: 525
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 504
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 525
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1998381620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)