BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0079.Seq (814 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g21630.1 68414.m02708 calcium-binding EF hand family protein ... 29 3.7 At2g20330.1 68415.m02374 transducin family protein / WD-40 repea... 28 8.5 >At1g21630.1 68414.m02708 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain; ESTs gb|T44428 and gb|AA395440 come from this gene Length = 1218 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 586 WGKPLGXTQXKSPXXXXPPFPPVGXXXXKRPXPXGLSP 699 WG P G Q P PP P G K P P LSP Sbjct: 528 WGHPQGFQQQPHPGGLRPPAGPKG----KPPRPVPLSP 561 >At2g20330.1 68415.m02374 transducin family protein / WD-40 repeat family protein similar to Transcriptional repressor rco-1 (SP:P78706) [Neurospora crassa]; similar to TUP1(GB:AF079369); contains 6 WD-40 repeats (PF00400) Length = 648 Score = 27.9 bits (59), Expect = 8.5 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Frame = +1 Query: 91 STKLESFSSLEL---YKP*SLSRSATCGVVLCTRGSFTFLVFDSQNLALAFYV 240 +++L+SF +E ++ S+S S T G LC GS +FD L L ++ Sbjct: 210 NSRLQSFRQIEPSEGHQVRSVSWSPTSGQFLCVTGSAQAKIFDRDGLTLGEFM 262 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,052,396 Number of Sequences: 28952 Number of extensions: 245899 Number of successful extensions: 487 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 477 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 487 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1853336000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -