BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0078.Seq (856 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 3.6 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 6.3 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 6.3 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 22 6.3 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 23.0 bits (47), Expect = 3.6 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -1 Query: 514 DSLEVFPDWLPKVSICLTTSMPSTTFPKTTCLPSSQ 407 ++L V+P++ V +C S ++ KT C +Q Sbjct: 641 ENLNVYPEFQENVQLCSEISESYSSNNKTLCKCDAQ 676 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 22.2 bits (45), Expect = 6.3 Identities = 6/15 (40%), Positives = 13/15 (86%) Frame = +1 Query: 181 GFGYKGSIFHRVIPN 225 GFGY+ ++ ++V+P+ Sbjct: 389 GFGYESNVKYQVVPS 403 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 22.2 bits (45), Expect = 6.3 Identities = 6/15 (40%), Positives = 13/15 (86%) Frame = +1 Query: 181 GFGYKGSIFHRVIPN 225 GFGY+ ++ ++V+P+ Sbjct: 389 GFGYESNVKYQVVPS 403 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 22.2 bits (45), Expect = 6.3 Identities = 6/15 (40%), Positives = 13/15 (86%) Frame = +1 Query: 181 GFGYKGSIFHRVIPN 225 GFGY+ ++ ++V+P+ Sbjct: 15 GFGYESNVKYQVVPS 29 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 242,020 Number of Sequences: 438 Number of extensions: 5307 Number of successful extensions: 15 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27552579 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -