BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0077.Seq (481 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6CQE6 Cluster: Kluyveromyces lactis strain NRRL Y-1140... 78 1e-13 UniRef50_A7SUM0 Cluster: Predicted protein; n=5; Nematostella ve... 69 4e-11 UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10; Eukaryo... 62 6e-09 UniRef50_Q16984 Cluster: Alpha-L1 nicotinic acetyl choline recep... 50 2e-05 UniRef50_Q99JC0 Cluster: RRNA promoter binding protein; n=28; Eu... 47 3e-04 UniRef50_Q7TP33 Cluster: Aa1-330; n=1; Rattus norvegicus|Rep: Aa... 46 3e-04 UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG0... 46 3e-04 UniRef50_Q3U1V2 Cluster: B6-derived CD11 +ve dendritic cells cDN... 39 0.051 UniRef50_A6N073 Cluster: Putative uncharacterized protein; n=1; ... 35 1.1 UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia ... 35 1.1 UniRef50_Q8CM04 Cluster: Putative uncharacterized protein; n=8; ... 33 2.5 UniRef50_A6BKX8 Cluster: Putative uncharacterized protein; n=8; ... 33 3.3 UniRef50_Q7QW44 Cluster: GLP_457_25625_26368; n=2; Giardia intes... 33 3.3 UniRef50_Q1E5U6 Cluster: Putative uncharacterized protein; n=1; ... 33 3.3 UniRef50_UPI0000F2DA74 Cluster: PREDICTED: hypothetical protein;... 32 7.7 UniRef50_A5KL04 Cluster: Putative uncharacterized protein; n=8; ... 32 7.7 UniRef50_Q9VJT3 Cluster: CG15286-PA; n=1; Drosophila melanogaste... 32 7.7 >UniRef50_Q6CQE6 Cluster: Kluyveromyces lactis strain NRRL Y-1140 chromosome D of strain NRRL Y- 1140 of Kluyveromyces lactis; n=2; Kluyveromyces lactis|Rep: Kluyveromyces lactis strain NRRL Y-1140 chromosome D of strain NRRL Y- 1140 of Kluyveromyces lactis - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 144 Score = 77.8 bits (183), Expect = 1e-13 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -3 Query: 194 QTRHAPVLRANPYSEVTDPICRLPLPTLFYRLEALHLGDLLRIWVRTG 51 Q H P+LRANPY EVTD CRLPL TLFY+LEA+HLGDLLR+ VR G Sbjct: 58 QGPHCPILRANPYPEVTDLFCRLPLSTLFYQLEAVHLGDLLRLSVRPG 105 >UniRef50_A7SUM0 Cluster: Predicted protein; n=5; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 123 Score = 69.3 bits (162), Expect = 4e-11 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 179 PVLRANPYSEVTDPICRLPLPTLFYRLEALHLGDLLRIWVR 57 P LRANP+ EVTD CRLPLPTLFY+ EA HLGDLLR+ VR Sbjct: 63 PTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGDLLRLLVR 103 >UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10; Eukaryota|Rep: Cytochrome P450 like_TBP - Nicotiana tabacum (Common tobacco) Length = 530 Score = 62.1 bits (144), Expect = 6e-09 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = -2 Query: 174 PQSQSLFRSYGSNLPTSLTYIILSTRGSSPWRPAADMGTN 55 PQSQS RSYGS LPTSL YI+ STRG SPWRP A +G N Sbjct: 224 PQSQSFSRSYGSILPTSLAYIVPSTRGCSPWRPDAFVGGN 263 >UniRef50_Q16984 Cluster: Alpha-L1 nicotinic acetyl choline receptor; n=1; Acheta domesticus|Rep: Alpha-L1 nicotinic acetyl choline receptor - Acheta domesticus (House cricket) Length = 39 Score = 50.4 bits (115), Expect = 2e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -3 Query: 152 EVTDPICRLPLPTLFYRLEALHLG 81 EVTDPICRLPLPT YRL+ALHLG Sbjct: 16 EVTDPICRLPLPTFVYRLDALHLG 39 >UniRef50_Q99JC0 Cluster: RRNA promoter binding protein; n=28; Euteleostomi|Rep: RRNA promoter binding protein - Rattus norvegicus (Rat) Length = 295 Score = 46.8 bits (106), Expect = 3e-04 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -1 Query: 208 IRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYS 107 +R P++P P EPILIPKLRI+ ADFPYLH S Sbjct: 146 LRAPARPTQPL--EPILIPKLRIRLADFPYLHCS 177 Score = 36.7 bits (81), Expect = 0.27 Identities = 22/50 (44%), Positives = 25/50 (50%), Gaps = 5/50 (10%) Frame = -3 Query: 182 APVLRANPYSEVTDPICRLPLPTLFY-----RLEALHLGDLLRIWVRTGA 48 AP P + P R+ L Y EA+HLGDLLRIWVR GA Sbjct: 148 APARPTQPLEPILIPKLRIRLADFPYLHCSNMPEAVHLGDLLRIWVRPGA 197 >UniRef50_Q7TP33 Cluster: Aa1-330; n=1; Rattus norvegicus|Rep: Aa1-330 - Rattus norvegicus (Rat) Length = 151 Score = 46.4 bits (105), Expect = 3e-04 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 97 RLFTLETCCGYGYEPARHLHVHP 29 RLFTLETCCGYGY PAR LH P Sbjct: 25 RLFTLETCCGYGYGPARDLHPLP 47 >UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG00134 - Rattus norvegicus (Rat) Length = 221 Score = 46.4 bits (105), Expect = 3e-04 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 97 RLFTLETCCGYGYEPARHLHVHP 29 RLFTLETCCGYGY PAR LH P Sbjct: 95 RLFTLETCCGYGYGPARDLHPLP 117 >UniRef50_Q3U1V2 Cluster: B6-derived CD11 +ve dendritic cells cDNA, RIKEN full-length enriched library, clone:F730204M12 product:hypothetical protein, full insert sequence; n=3; Amniota|Rep: B6-derived CD11 +ve dendritic cells cDNA, RIKEN full-length enriched library, clone:F730204M12 product:hypothetical protein, full insert sequence - Mus musculus (Mouse) Length = 136 Score = 39.1 bits (87), Expect = 0.051 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 12 LENSGEGCTWRCRAGSYPYPQQVSKVKSL 98 L+ G GC + RAG YPYPQQVSKV SL Sbjct: 104 LKIRGRGC--KSRAGPYPYPQQVSKVNSL 130 >UniRef50_A6N073 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (indica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 39 Score = 34.7 bits (76), Expect = 1.1 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = +3 Query: 105 IE*CR*GKSANWIRNFGIRIGSE 173 +E CR GKSA IRNFG RIGSE Sbjct: 1 MEQCRQGKSAKRIRNFGKRIGSE 23 >UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia ATCC 50803|Rep: GLP_748_1200_211 - Giardia lamblia ATCC 50803 Length = 329 Score = 34.7 bits (76), Expect = 1.1 Identities = 18/37 (48%), Positives = 21/37 (56%) Frame = -2 Query: 171 QSQSLFRSYGSNLPTSLTYIILSTRGSSPWRPAADMG 61 QS S R YG+ LPTSL+ + RG P PAA G Sbjct: 290 QSHSFSRGYGAGLPTSLSRVRSRARGCWPRSPAAWWG 326 >UniRef50_Q8CM04 Cluster: Putative uncharacterized protein; n=8; Bacteria|Rep: Putative uncharacterized protein - Corynebacterium efficiens Length = 261 Score = 33.5 bits (73), Expect = 2.5 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = -1 Query: 181 PRSSEPILIPKLRIQFADFPYLHYSID*RL--FTLETCCGYGYEPARHL 41 P + L+PKLR FA+F L++S RL L TC G GY P H+ Sbjct: 95 PSPVQAPLLPKLRGHFAEF--LNHSSPERLSILYLTTCVGLGYGPNMHI 141 >UniRef50_A6BKX8 Cluster: Putative uncharacterized protein; n=8; Clostridiales|Rep: Putative uncharacterized protein - Dorea longicatena DSM 13814 Length = 109 Score = 33.1 bits (72), Expect = 3.3 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = -2 Query: 162 SLFRSYGSNLPTSLTYIILSTRGSSPWRPAADMGT 58 S RSYG LP+SLT ++ S G SP P + GT Sbjct: 13 SFSRSYGVILPSSLTMLLPSALGFSPHPPVSVYGT 47 >UniRef50_Q7QW44 Cluster: GLP_457_25625_26368; n=2; Giardia intestinalis|Rep: GLP_457_25625_26368 - Giardia lamblia ATCC 50803 Length = 247 Score = 33.1 bits (72), Expect = 3.3 Identities = 19/48 (39%), Positives = 24/48 (50%) Frame = -2 Query: 456 ADR*TAVVQNRADRARNETDTTLRLGRSAEGRRTRVRIQSET*DDFRE 313 ADR N NET + GR A+GRR R++SE D FR+ Sbjct: 55 ADRLVDTANNTFIHEINETSACMICGRIADGRRVIDRVRSEAVDFFRK 102 >UniRef50_Q1E5U6 Cluster: Putative uncharacterized protein; n=1; Coccidioides immitis|Rep: Putative uncharacterized protein - Coccidioides immitis Length = 656 Score = 33.1 bits (72), Expect = 3.3 Identities = 14/50 (28%), Positives = 28/50 (56%) Frame = -2 Query: 150 SYGSNLPTSLTYIILSTRGSSPWRPAADMGTNRRDISTYIPHLNFQGAAE 1 S G +LP +Y L+ + + WRP+A + D ++ L+++G+A+ Sbjct: 180 SDGKSLPKVYSYNDLNGKSNGKWRPSAIKSIDGEDAQQWLRRLSYRGSAQ 229 >UniRef50_UPI0000F2DA74 Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 380 Score = 31.9 bits (69), Expect = 7.7 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = -1 Query: 241 ARTSTRPGTGXIRFPSKPDTPRSSEPILIPKLRIQFADFPYL 116 AR PG P +P TPRS P+ P++R P L Sbjct: 94 ARPEACPGPAACSRPERPPTPRSFHPLRSPRVRFSAPPAPLL 135 >UniRef50_A5KL04 Cluster: Putative uncharacterized protein; n=8; Clostridiales|Rep: Putative uncharacterized protein - Ruminococcus torques ATCC 27756 Length = 259 Score = 31.9 bits (69), Expect = 7.7 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -1 Query: 163 ILIPKLRIQFADFPYLHYSID*RLFTLETCCG--YGY 59 +L+PKLR FA+F +D R+ + TC G YGY Sbjct: 19 LLLPKLRSHFAEFLNNASPVDLRILSSSTCVGLRYGY 55 >UniRef50_Q9VJT3 Cluster: CG15286-PA; n=1; Drosophila melanogaster|Rep: CG15286-PA - Drosophila melanogaster (Fruit fly) Length = 511 Score = 31.9 bits (69), Expect = 7.7 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -2 Query: 111 ILSTRGSSPWRPAADMGTNRRDISTYIPHLNFQGAA 4 ++ TR ++P +PAA++G N R I+ Y P F A+ Sbjct: 316 VIRTRHANPAQPAANIGNNTRSINVYGPTSAFTQAS 351 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 502,517,310 Number of Sequences: 1657284 Number of extensions: 10049059 Number of successful extensions: 28807 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 27853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28801 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 27290400475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -