BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0077.Seq (481 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.36 SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 27 1.9 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 4.5 SPAC27F1.07 |||dolichyl-diphospho-oligosaccharide-protein glycos... 25 7.8 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.36 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 385 ARKIRGRPENAGPDPVRNVRRFSRV 311 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 26.6 bits (56), Expect = 1.9 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 202 SGCXRCRVWSMFVRYVRLAS*YFNIMRPQKLYIF 303 +GC + VW +VR+V Y LY++ Sbjct: 108 NGCGKSYVWPSYVRFVDFDERYTRFANKYSLYLY 141 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.4 bits (53), Expect = 4.5 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 127 FPYLHYSID*RLFTLETCCGYGYEPARHL 41 +P+ S+D R+F LE+ GY EP L Sbjct: 159 YPFDLDSLDKRIFKLESKIGYADEPLSEL 187 >SPAC27F1.07 |||dolichyl-diphospho-oligosaccharide-protein glycosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 450 Score = 24.6 bits (51), Expect = 7.8 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = +2 Query: 296 IYLI*HSRKSSYVSDWIRTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQNWHGQ 475 +YL S Y +D RTR++ PSA + + ++ R T V S + G+ Sbjct: 136 VYLTTLYLDSPYTTDLQRTRLILPSAKIDTYTTYNIDGAELPNRVGNTLVYESRETITGE 195 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,975,442 Number of Sequences: 5004 Number of extensions: 38858 Number of successful extensions: 93 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 184020746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -