BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0076.Seq (860 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 22 7.2 AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 21 9.5 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 21.8 bits (44), Expect = 7.2 Identities = 20/77 (25%), Positives = 26/77 (33%) Frame = -1 Query: 290 QPDSKERPSRRDLRRYGXGTLYGKTAPFKTNLDRSRRDEKAEPPEHHISRYRLKQRDSVL 111 QP + P L YG G Y A K S KA EH + Y K +L Sbjct: 61 QPTTGYYPYDPALAAYGYGAGYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIML 120 Query: 110 GYIPVRSPLLRKSWLVS 60 I + +W + Sbjct: 121 AIITKMTLTQVSTWFAN 137 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 727 LGLPNVXRAKNRYQGRLAHLXETIH 801 L L + R++ RYQGR++ L I+ Sbjct: 38 LPLRSFYRSRIRYQGRISSLILPIY 62 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,552 Number of Sequences: 336 Number of extensions: 3686 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23866870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -