BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0076.Seq (860 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC144.14 |klp8||kinesin-like protein Klp8|Schizosaccharomyces ... 27 4.5 SPBC359.04c |||DIPSY family|Schizosaccharomyces pombe|chr 2|||Ma... 26 6.0 SPCC4E9.01c |rec11|SPCC550.16c|meiotic cohesin complex subunit R... 26 6.0 >SPAC144.14 |klp8||kinesin-like protein Klp8|Schizosaccharomyces pombe|chr 1|||Manual Length = 511 Score = 26.6 bits (56), Expect = 4.5 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +1 Query: 691 FQFGNKIQLLKELGLPNV--XRAKNRYQGRLAHLXETI 798 F F +K LKE G PN+ + N +QG L+ L + + Sbjct: 442 FNFDDKNVKLKEFGSPNIAYKQELNSFQGELSSLFKDL 479 >SPBC359.04c |||DIPSY family|Schizosaccharomyces pombe|chr 2|||Manual Length = 358 Score = 26.2 bits (55), Expect = 6.0 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = -2 Query: 295 SSNPTLRSVPLAATSVATGXAPSTGKRPRSRRTWTGVVATRKRNLPNTTS 146 SS P SVP +++ ++ P+T P + T T +P+++S Sbjct: 95 SSTPITASVPTSSSILSNSTIPTTSPVPTTSSTPTSSSILSNSTIPSSSS 144 >SPCC4E9.01c |rec11|SPCC550.16c|meiotic cohesin complex subunit Rec11|Schizosaccharomyces pombe|chr 3|||Manual Length = 923 Score = 26.2 bits (55), Expect = 6.0 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +1 Query: 7 PNSARAPPNLSILVSGGKETNQDFLS 84 PN AR P LS LV G KET D LS Sbjct: 899 PNRARDPGTLSHLVKGLKET-ADHLS 923 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,255,969 Number of Sequences: 5004 Number of extensions: 62167 Number of successful extensions: 150 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 150 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 428468660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -