BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0076.Seq (860 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 97 1e-20 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 4e-20 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 90 2e-18 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 4e-18 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 4e-18 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 4e-18 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 88 8e-18 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 2e-17 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 2e-17 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 2e-17 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 2e-17 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 2e-17 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 86 3e-17 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 3e-17 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 86 3e-17 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 86 4e-17 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 86 4e-17 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 86 4e-17 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 86 4e-17 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 86 4e-17 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 86 4e-17 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 86 4e-17 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 86 4e-17 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 86 4e-17 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 86 4e-17 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 86 4e-17 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 86 4e-17 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 86 4e-17 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 86 4e-17 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 86 4e-17 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 86 4e-17 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 86 4e-17 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 86 4e-17 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 86 4e-17 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 86 4e-17 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 86 4e-17 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 86 4e-17 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 86 4e-17 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 86 4e-17 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 86 4e-17 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 86 4e-17 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 86 4e-17 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 86 4e-17 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 86 4e-17 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 86 4e-17 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 86 4e-17 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 86 4e-17 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 86 4e-17 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 86 4e-17 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 86 4e-17 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 86 4e-17 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 86 4e-17 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 86 4e-17 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 86 4e-17 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 86 4e-17 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 86 4e-17 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 86 4e-17 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 86 4e-17 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 86 4e-17 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 86 4e-17 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 86 4e-17 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 86 4e-17 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 86 4e-17 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 86 4e-17 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 86 4e-17 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 86 4e-17 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 86 4e-17 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 86 4e-17 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 9e-17 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 84 1e-16 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 84 2e-16 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 84 2e-16 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 84 2e-16 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 84 2e-16 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 84 2e-16 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 84 2e-16 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 84 2e-16 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 84 2e-16 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 84 2e-16 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 84 2e-16 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 84 2e-16 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 84 2e-16 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 84 2e-16 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 84 2e-16 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 84 2e-16 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 84 2e-16 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 84 2e-16 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 84 2e-16 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 84 2e-16 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 84 2e-16 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 84 2e-16 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 84 2e-16 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 84 2e-16 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 84 2e-16 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 84 2e-16 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 84 2e-16 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 84 2e-16 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 84 2e-16 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 84 2e-16 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 84 2e-16 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 84 2e-16 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 84 2e-16 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 84 2e-16 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 84 2e-16 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 84 2e-16 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 84 2e-16 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 84 2e-16 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 84 2e-16 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 97.5 bits (232), Expect = 1e-20 Identities = 47/58 (81%), Positives = 48/58 (82%), Gaps = 1/58 (1%) Frame = +1 Query: 382 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPDRSXFP-TVXXLNGXW 552 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP P + LNG W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 95.9 bits (228), Expect = 4e-20 Identities = 48/64 (75%), Positives = 52/64 (81%), Gaps = 2/64 (3%) Frame = +1 Query: 367 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAK--RPDRSXFPTVXXL 540 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQHIPLSPAGVIA+ R DR + L Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPS-QQLRSL 91 Query: 541 NGXW 552 NG W Sbjct: 92 NGEW 95 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 89.8 bits (213), Expect = 2e-18 Identities = 44/61 (72%), Positives = 45/61 (73%), Gaps = 3/61 (4%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWRXANCXR* 569 [lacZ-alpha fragment, 36 aa] RP S EWR C + Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCGQN 112 Query: 570 Y 572 Y Sbjct: 113 Y 113 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 89.0 bits (211), Expect = 4e-18 Identities = 43/59 (72%), Positives = 44/59 (74%), Gaps = 3/59 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWRXANCXR 566 [lacZ-alpha fragment, 36 aa] RP S EWR C + Sbjct: 170 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCDK 228 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 89.0 bits (211), Expect = 4e-18 Identities = 48/79 (60%), Positives = 50/79 (63%), Gaps = 3/79 (3%) Frame = +3 Query: 321 TPSKAKYDREGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 500 TP+ A+ DR G LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 6 TPAAARRDRAAGD-PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 64 Query: 501 EA---RPIALPNSXAXEWR 548 EA RP S EWR Sbjct: 65 EARTDRPSQQLRSLNGEWR 83 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 89.0 bits (211), Expect = 4e-18 Identities = 48/79 (60%), Positives = 53/79 (67%), Gaps = 4/79 (5%) Frame = +3 Query: 324 PSKAKYD-REGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 500 PS++ +D R+G P+ LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 9 PSRSSFDPRKGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 66 Query: 501 EA---RPIALPNSXAXEWR 548 EA RP S EWR Sbjct: 67 EARTDRPSQQLRSLNGEWR 85 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 88.2 bits (209), Expect = 8e-18 Identities = 44/62 (70%), Positives = 45/62 (72%), Gaps = 3/62 (4%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWRXANCXR* 569 [lacZ-alpha fragment, 36 aa] RP S EWR R Sbjct: 191 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYMRD 250 Query: 570 YF 575 Y+ Sbjct: 251 YY 252 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 87.4 bits (207), Expect = 1e-17 Identities = 44/62 (70%), Positives = 48/62 (77%), Gaps = 2/62 (3%) Frame = +1 Query: 373 PIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAK--RPDRSXFPTVXXLNG 546 P +SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAG+ + R DR + LNG Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPS-QQLRSLNG 135 Query: 547 XW 552 W Sbjct: 136 EW 137 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 87.0 bits (206), Expect = 2e-17 Identities = 46/72 (63%), Positives = 48/72 (66%), Gaps = 3/72 (4%) Frame = +3 Query: 342 DREGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RP 512 D+EG P+ [lacZ-alpha fragment, 36 aa] RP Sbjct: 7 DKEGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 64 Query: 513 IALPNSXAXEWR 548 S EWR Sbjct: 65 SQQLRSLNGEWR 76 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 87.0 bits (206), Expect = 2e-17 Identities = 45/73 (61%), Positives = 49/73 (67%), Gaps = 3/73 (4%) Frame = +3 Query: 339 YDREGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---R 509 Y+++G P+ [lacZ-alpha fragment, 36 aa] R Sbjct: 36 YEKDGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR 93 Query: 510 PIALPNSXAXEWR 548 P S EWR Sbjct: 94 PSQQLRSLNGEWR 106 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 86.6 bits (205), Expect = 2e-17 Identities = 48/74 (64%), Positives = 49/74 (66%), Gaps = 3/74 (4%) Frame = +3 Query: 336 KYDREGGPVXXXXXXXXXXXX[lacZ-alpha fragment, 36 aa] 506 KYD EG P+ [lacZ-alpha fragment, 36 aa] Sbjct: 29 KYD-EGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 85 Query: 507 RPIALPNSXAXEWR 548 RP S EWR Sbjct: 86 RPSQQLRSLNGEWR 99 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 86.6 bits (205), Expect = 2e-17 Identities = 48/79 (60%), Positives = 51/79 (64%), Gaps = 3/79 (3%) Frame = +3 Query: 321 TPSKAKYDREGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 500 TP + +Y EG P+ LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 134 TPQENRY--EGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 189 Query: 501 EA---RPIALPNSXAXEWR 548 EA RP S EWR Sbjct: 190 EARTDRPSQQLRSLNGEWR 208 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 86.6 bits (205), Expect = 2e-17 Identities = 44/59 (74%), Positives = 47/59 (79%), Gaps = 2/59 (3%) Frame = +1 Query: 382 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAK--RPDRSXFPTVXXLNGXW 552 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV ++ R DR + LNG W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPS-QQLRSLNGEW 59 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 86.2 bits (204), Expect = 3e-17 Identities = 45/74 (60%), Positives = 48/74 (64%), Gaps = 3/74 (4%) Frame = +3 Query: 336 KYDREGGPVXXXXXXXXXXXX[lacZ-alpha fragment, 36 aa] 506 +Y + G P+ [lacZ-alpha fragment, 36 aa] Sbjct: 54 RYQKSGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 111 Query: 507 RPIALPNSXAXEWR 548 RP S EWR Sbjct: 112 RPSQQLRSLNGEWR 125 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 86.2 bits (204), Expect = 3e-17 Identities = 45/74 (60%), Positives = 49/74 (66%), Gaps = 3/74 (4%) Frame = +3 Query: 336 KYDREGGPVXXXXXXXXXXXX[lacZ-alpha fragment, 36 aa] 506 ++D +G P+ [lacZ-alpha fragment, 36 aa] Sbjct: 43 RHDAQGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 100 Query: 507 RPIALPNSXAXEWR 548 RP S EWR Sbjct: 101 RPSQQLRSLNGEWR 114 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 86.2 bits (204), Expect = 3e-17 Identities = 43/59 (72%), Positives = 43/59 (72%), Gaps = 3/59 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWRXANCXR 566 [lacZ-alpha fragment, 36 aa] RP S EWR R Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRTKR 109 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 114 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 77 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 101 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 80 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 68 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 81 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 70 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 68 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 885 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 68 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 166 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 91 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 72 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 63 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 71 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 140 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 89 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 184 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 74 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 205 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 109 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 73 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 112 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 68 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 265 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 85 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 100 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 92 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 127 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 74 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 109 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 152 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 125 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 80 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 198 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 111 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 140 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 152 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 1190 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 1242 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 508 RASSLLRQLAKGGCAARRLSW 446 RASSLLRQLAKGGCAARRLSW Sbjct: 419 RASSLLRQLAKGGCAARRLSW 439 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 84 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 177 Score = 31.5 bits (68), Expect = 0.91 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -2 Query: 352 PSRSYLALDGVYHPLRAALSSNPTLR 275 P ALDG YHP AA +NPT R Sbjct: 52 PQAPRSALDGFYHPFWAAFPNNPTRR 77 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 77 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 129 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 83 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 68 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 86 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 88 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 148 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 113 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 136 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 92 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 136 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 136 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 73 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 117 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 76 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 160 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 68 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 95 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 128 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 119 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 143 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 93 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 1063 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 1115 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 69 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 83 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 186 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 234 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 111 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 71 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 198 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 110 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 168 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 75 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 704 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 91 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 213 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 84 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 74 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 110 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 122 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 69 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 112 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +3 Query: 456 RLAAHPPFASWRNSEEAR 509 +++AHPPFASWRNSEEAR Sbjct: 14 QVSAHPPFASWRNSEEAR 31 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 123 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 131 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 237 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 496 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 125 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 318 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 72 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 86 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 113 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 122 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 156 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 115 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 125 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 125 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 69 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 126 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 135 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 228 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 135 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 72 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 101 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 194 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 120 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 109 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 121 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 72 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 68 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 90 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 96 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 114 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 133 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 87 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 139 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 156 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 90 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 102 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 101 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 93 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 74 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 72 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 178 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 95 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 121 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 107 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 70 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 140 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 107 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 110 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 72 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 94 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 146 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 117 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 167 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 219 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 94 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 69 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 131 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 109 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 86 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 105 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 157 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 98 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 88 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 171 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 152 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 204 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 102 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 154 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 86 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 78 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 107 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 89 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 108 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 27 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 79 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 121 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 178 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 110 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 89 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 141 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 70 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 78 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 123 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 137 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 96 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 145 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 145 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 197 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 791 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 843 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 72 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 124 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 145 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 107 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 159 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 68 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 133 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 160 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 68 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 306 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 358 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 82 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 104 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 15 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 67 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 78 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 68 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 108 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 247 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 299 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 133 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 86 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 100 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 68 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 76 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 204 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 256 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 115 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 70 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 87 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 719 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 771 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 91 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 529 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 581 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 89 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 68 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 187 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 239 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 68 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 115 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 167 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 82 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 72 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 137 >SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 63 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 84 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 161 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 73 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 89 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 198 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 250 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 112 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 73 >SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 68 >SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 27 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 79 >SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 93 >SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 72 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 119 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 76 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 96 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 114 >SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 92 >SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 72 >SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) Length = 191 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 121 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 173 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 121 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 364 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 416 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 93 >SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 88 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 106 >SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 68 >SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 133 >SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) Length = 630 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP S EWR Sbjct: 437 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 489 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 84.6 bits (200), Expect = 9e-17 Identities = 41/53 (77%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEWR 548 [lacZ-alpha fragment, 36 aa] RP + EWR Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTLNGEWR 91 >SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 916 Score = 84.2 bits (199), Expect = 1e-16 Identities = 41/52 (78%), Positives = 41/52 (78%), Gaps = 3/52 (5%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA---RPIALPNSXAXEW 545 [lacZ-alpha fragment, 36 aa] RP S EW Sbjct: 825 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQMRSLNGEW 876 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 84.2 bits (199), Expect = 1e-16 Identities = 45/58 (77%), Positives = 45/58 (77%) Frame = -2 Query: 508 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL*YDSL*GELGTGPPSRSYL 335 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE L G GP SYL Sbjct: 129 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE-----LTGSKQRGPSVGSYL 181 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 83.8 bits (198), Expect = 2e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 509 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 71 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 83.8 bits (198), Expect = 2e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 509 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 65 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 83.8 bits (198), Expect = 2e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 509 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 80 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 83.8 bits (198), Expect = 2e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 509 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 72 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 83.8 bits (198), Expect = 2e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 509 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 98 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 83.8 bits (198), Expect = 2e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 399 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 509 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 103 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,162,316 Number of Sequences: 59808 Number of extensions: 523234 Number of successful extensions: 6139 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6114 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2455286845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -