BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0075.Seq (799 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0575 - 18654887-18655047,18656182-18656242,18656777-18657250 29 4.3 06_02_0043 - 10906806-10907036,10907757-10907897 28 7.5 >09_04_0575 - 18654887-18655047,18656182-18656242,18656777-18657250 Length = 231 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +2 Query: 524 RRIFSVGRVSDPVVDSAXNGLLLGDRV 604 RR VG V D VVD+A G LG+RV Sbjct: 95 RRCGRVGHVEDVVVDAAARGRGLGERV 121 >06_02_0043 - 10906806-10907036,10907757-10907897 Length = 123 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -2 Query: 612 MLLTRSPSKSPXFAESTTGSETR-PTEKIRRETQWPCIYPLDP 487 +LL RSP P A + S R P+ ++RRE P PLDP Sbjct: 2 VLLERSPLVVPEAAAAAASSPLRRPSPRVRREVPPP---PLDP 41 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,930,238 Number of Sequences: 37544 Number of extensions: 278026 Number of successful extensions: 522 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 517 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2162420256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -