BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0073.Seq (851 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 31 0.009 AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical pro... 23 4.1 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 31.5 bits (68), Expect = 0.009 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +1 Query: 526 YQGDGPLREPSP*SSFLGSRCRKALNRNPKXSPDLELDGENRRTWREKE 672 +Q + P P+P S + RK N N S + E+ G R+TW+ +E Sbjct: 66 WQANSPPSPPAP-SELPALKSRKLNNNNVVSSTNQEIRGPKRKTWKVEE 113 >AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical protein protein. Length = 148 Score = 22.6 bits (46), Expect = 4.1 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = +1 Query: 427 KRIDRDRVECCSSLEQESTIKERGLQRQGRK 519 K ID +++C +S +++ E+G + GR+ Sbjct: 53 KTIDFRKIQCSNSPLRKARYTEKGTCKMGRE 83 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,361 Number of Sequences: 336 Number of extensions: 3531 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23555563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -