BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0070.Seq (847 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit ... 27 4.4 >SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit Bgs4|Schizosaccharomyces pombe|chr 3|||Manual Length = 1955 Score = 26.6 bits (56), Expect = 4.4 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = -3 Query: 668 IFNIIILVYYYGNARAH*THGITGLFCFRTIPIFFFHRYCKYIQSIVFFSS 516 I++++ + YY GN + I C++ P+ + + C IVF+ S Sbjct: 1381 IYHVVTVCYYNGNQKLSYDTSIVPRGCYQLGPVLSWLKRCVISIFIVFWIS 1431 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,292,201 Number of Sequences: 5004 Number of extensions: 66798 Number of successful extensions: 110 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 418457710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -