Bombyx BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ps4M0070.Seq
         (847 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_6883| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   8.3  
SB_11504| Best HMM Match : No HMM Matches (HMM E-Value=.)              25   9.7  

>SB_6883| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1170

 Score = 28.3 bits (60), Expect = 8.3
 Identities = 10/36 (27%), Positives = 21/36 (58%)
 Frame = +1

Query: 322 TCTNSSKKIFKCSLKCLLIAFDKVHFKQSIYS*FDV 429
           +CTN +  + +C LKC  +  D+V  +  ++S  ++
Sbjct: 161 SCTNGNAWLSRCRLKCERLFSDRVCLRHGVWSGMEI 196


>SB_11504| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 44

 Score = 25.0 bits (52), Expect(2) = 9.7
 Identities = 7/15 (46%), Positives = 12/15 (80%)
 Frame = -1

Query: 157 YYYHYYVC*FLEDHK 113
           YYY+YY C F ++++
Sbjct: 27  YYYYYYCCYFQQEYQ 41



 Score = 21.8 bits (44), Expect(2) = 9.7
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -1

Query: 166 SAVYYYHYY 140
           S  YYYHYY
Sbjct: 2   SYYYYYHYY 10


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,577,794
Number of Sequences: 59808
Number of extensions: 440303
Number of successful extensions: 877
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 749
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 849
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2395401800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)