BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0070.Seq (847 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6883| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_11504| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.7 >SB_6883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +1 Query: 322 TCTNSSKKIFKCSLKCLLIAFDKVHFKQSIYS*FDV 429 +CTN + + +C LKC + D+V + ++S ++ Sbjct: 161 SCTNGNAWLSRCRLKCERLFSDRVCLRHGVWSGMEI 196 >SB_11504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.0 bits (52), Expect(2) = 9.7 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = -1 Query: 157 YYYHYYVC*FLEDHK 113 YYY+YY C F ++++ Sbjct: 27 YYYYYYCCYFQQEYQ 41 Score = 21.8 bits (44), Expect(2) = 9.7 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -1 Query: 166 SAVYYYHYY 140 S YYYHYY Sbjct: 2 SYYYYYHYY 10 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,577,794 Number of Sequences: 59808 Number of extensions: 440303 Number of successful extensions: 877 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2395401800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -