BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0070.Seq (847 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81533-4|CAB04338.1| 280|Caenorhabditis elegans Hypothetical pr... 31 1.0 U21310-4|AAA62518.1| 165|Caenorhabditis elegans Hypothetical pr... 30 2.4 >Z81533-4|CAB04338.1| 280|Caenorhabditis elegans Hypothetical protein F36G9.7 protein. Length = 280 Score = 31.1 bits (67), Expect = 1.0 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +3 Query: 237 VKYLFSSWFVLVK*QMLQKFSSLPFLRKYLYKF**KNIQMFSQVPTYSF 383 + +LFSS F L+ Q FS +PF + +Y K Q FS P Y + Sbjct: 199 IHHLFSSIFNLIV-NFCQLFSPIPFSNEAIYYVLNKPFQHFSSFPYYEY 246 >U21310-4|AAA62518.1| 165|Caenorhabditis elegans Hypothetical protein F40H6.1 protein. Length = 165 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 553 IANTFNQLCSFRVLKEGNRNVINVMYFILLGVIFFQG 443 I T SF + K+ N ++ + M+F L+G +FF G Sbjct: 113 IGTTILATISFAIAKDSNMSMGSSMWFCLVGGVFFNG 149 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,599,220 Number of Sequences: 27780 Number of extensions: 357115 Number of successful extensions: 677 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 677 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2098003600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -