BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0069.Seq (830 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 3.0 AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esteras... 21 9.1 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +2 Query: 707 LQRPKGEKTGLFRAXGPXTEPFTLIQGFXGGP 802 L P G L + GP + P+T+I P Sbjct: 107 LSSPSGNVPPLTPSPGPPSHPYTVISNGYSSP 138 >AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esterase protein. Length = 510 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +1 Query: 640 TEIGLNVVPSFGTRVPLI*RTWTPTSKGRKN 732 T N P+ + PLI TW P ++ N Sbjct: 469 TSFAKNGDPNPKEKTPLINVTWKPVTQNEMN 499 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,263 Number of Sequences: 336 Number of extensions: 4075 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22829180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -