BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0067.Seq (825 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07671.1 68415.m00894 H+-transporting two-sector ATPase, C su... 44 2e-04 At4g11170.1 68417.m01809 disease resistance protein (TIR-NBS-LRR... 28 8.7 >At2g07671.1 68415.m00894 H+-transporting two-sector ATPase, C subunit family protein similar to ATPase subunit 9 [Arabidopsis thaliana] GI:15215920; contains Pfam profile PF00137: ATP synthase subunit C Length = 85 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 332 FGSLIIGYARNPSLKQQLFSYAILGFALSE 421 F SLI ARNPSL +Q F YAILGFAL+E Sbjct: 39 FSSLIHSVARNPSLAKQSFGYAILGFALTE 68 >At4g11170.1 68417.m01809 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1095 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +1 Query: 67 LIKTKCCLPPD*SPLQPGLPSSATLH--WCDHLQQYPPI 177 L++ CC + P LPS LH +C LQ +P I Sbjct: 682 LLEMSCCKKLEIIPTNINLPSLEVLHFRYCTRLQTFPEI 720 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,807,768 Number of Sequences: 28952 Number of extensions: 376459 Number of successful extensions: 1121 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1075 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1120 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1892353600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -