BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0064.Seq (403 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 2.6 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 21 6.0 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.8 bits (44), Expect = 2.6 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = +3 Query: 261 LKLRSGLTFNPYL*TIVGEPTMLNGDLLERQDTYWVVKLR**KKKNS 401 L+L FN Y+ N +L ERQ W R KKNS Sbjct: 256 LELEKEFLFNAYVSKQKRWELARNLNLTERQVKIWFQNRRMKNKKNS 302 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 20.6 bits (41), Expect = 6.0 Identities = 8/27 (29%), Positives = 11/27 (40%) Frame = -3 Query: 206 NQIVNVC*SAIGGYSHNRVQCA*CEFF 126 NQ+ VC G+ C C+ F Sbjct: 2 NQLCKVCGEPAAGFHFGAFTCEGCKSF 28 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,068 Number of Sequences: 336 Number of extensions: 1616 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8646818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -