BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0064.Seq (403 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY051563-1|AAK92987.1| 634|Drosophila melanogaster GH21160p pro... 29 1.8 AE013599-1301|AAM68737.1| 634|Drosophila melanogaster CG30023-P... 29 1.8 AE014297-3099|AAN13902.1| 595|Drosophila melanogaster CG31164-P... 27 9.4 >AY051563-1|AAK92987.1| 634|Drosophila melanogaster GH21160p protein. Length = 634 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +1 Query: 10 SVLSANF*SSQSSRPSGKRRETVPTPYKFELTXTLSR 120 SV S +F S S+P+ + R T PTP K L +L R Sbjct: 534 SVKSLDFDSENESKPATETRTTRPTPPKKPLRLSLQR 570 >AE013599-1301|AAM68737.1| 634|Drosophila melanogaster CG30023-PA protein. Length = 634 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +1 Query: 10 SVLSANF*SSQSSRPSGKRRETVPTPYKFELTXTLSR 120 SV S +F S S+P+ + R T PTP K L +L R Sbjct: 534 SVKSLDFDSENESKPATETRTTRPTPPKKPLRLSLQR 570 >AE014297-3099|AAN13902.1| 595|Drosophila melanogaster CG31164-PA protein. Length = 595 Score = 27.1 bits (57), Expect = 9.4 Identities = 22/56 (39%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = +3 Query: 138 LSTLHAVVAI-ATNSRSTNIYDLII--FLIFLQVFKPILPYCM*LKLRSGLTFNPY 296 L L AV AI S +N Y L I F +F+ +F + KLRS LT PY Sbjct: 340 LINLRAVRAILGQTSPISNRYSLSIQHFFVFMSLFGTLFGGFFDCKLRSFLTKRPY 395 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,314,532 Number of Sequences: 53049 Number of extensions: 255961 Number of successful extensions: 290 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 290 length of database: 24,988,368 effective HSP length: 77 effective length of database: 20,903,595 effective search space used: 1170601320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -