BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0063.Seq (808 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF067613-4|AAU20845.1| 327|Caenorhabditis elegans Hypothetical ... 28 6.8 Z92833-2|CAB07379.1| 891|Caenorhabditis elegans Hypothetical pr... 28 9.0 >AF067613-4|AAU20845.1| 327|Caenorhabditis elegans Hypothetical protein F56D6.7 protein. Length = 327 Score = 28.3 bits (60), Expect = 6.8 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -3 Query: 617 SILLIYKGFCRFRPYWLKNELI*QKFNANFNKILTLKFAIRHS 489 S+L I K F P W KN LI QKF + +L L ++++ Sbjct: 123 SLLAIEKFLIYFFPSWEKNVLIVQKFVQKYILLLYLGCCLKYA 165 >Z92833-2|CAB07379.1| 891|Caenorhabditis elegans Hypothetical protein F38A6.2 protein. Length = 891 Score = 27.9 bits (59), Expect = 9.0 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -1 Query: 505 LPFAIQXAQLLGRAIGAGLFAITPAGE--RGMCCKAIKLGNARV 380 L F+ L G++IGA L T AGE G K +K G++RV Sbjct: 761 LDFSSDSQYLRGQSIGAHLLFWTKAGEICDGTSVKDVKWGSSRV 804 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,301,455 Number of Sequences: 27780 Number of extensions: 327331 Number of successful extensions: 641 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 641 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1977346024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -