BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0063.Seq (808 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02110.1 68418.m00132 cyclin family protein low similarity to... 28 6.3 At2g18760.1 68415.m02184 SNF2 domain-containing protein / helica... 28 8.4 >At5g02110.1 68418.m00132 cyclin family protein low similarity to cyclin D3.1 from [Lycopersicon esculentum] GI:5679622, [Nicotiana tabacum] GI:4160300; contains Pfam profiles PF00134: Cyclin, N-terminal domain, PF02984: Cyclin, C-terminal domain Length = 341 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 258 FNVYRVKKKKKTRGGARYPIRPIVSRITIHWPSF 359 F ++R +KKK+ RG + IRP R+TI ++ Sbjct: 308 FQIFRYEKKKRDRGNHQDNIRP-AKRMTIEMSNY 340 >At2g18760.1 68415.m02184 SNF2 domain-containing protein / helicase domain-containing protein similar to SP|Q03468 Excision repair protein ERCC-6 (Cockayne syndrome protein CSB) {Homo sapiens}; contains PFam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 1187 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/55 (29%), Positives = 24/55 (43%) Frame = +3 Query: 321 PIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 485 PI +++T W F V GK LP A +P++ G P ++ CA Sbjct: 576 PIQNKLTELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANASPLQVSTAYRCA 630 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,438,072 Number of Sequences: 28952 Number of extensions: 307140 Number of successful extensions: 579 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1833827200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -