BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0062.Seq (512 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isome... 23 2.4 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 21 5.7 AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 21 9.9 >EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isomerase protein. Length = 247 Score = 22.6 bits (46), Expect = 2.4 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 376 AGLKVFGSLRSEITERSTVRTDCVGFQR 293 +GLKV + ++ ER +TD V F++ Sbjct: 118 SGLKVIACIGEKLEEREAGKTDEVVFRQ 145 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 21.4 bits (43), Expect = 5.7 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +1 Query: 115 YQGGYFKAHMKFPPDYPY 168 + G F+ +KF P YP+ Sbjct: 305 FDGRLFEFPIKFVPSYPF 322 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 20.6 bits (41), Expect = 9.9 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -1 Query: 224 FSYTFGCQTLVKNLMDGGEYG*SGGNFMCALKY 126 F + + + L G YG GN C++ + Sbjct: 21 FVWIYALSLSLPPLFGWGSYGPEAGNVSCSVSW 53 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,796 Number of Sequences: 438 Number of extensions: 3832 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14232156 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -