BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0062.Seq (512 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g46460.1 68416.m05037 ubiquitin-conjugating enzyme 13 (UBC13)... 122 2e-28 At3g55380.1 68416.m06151 ubiquitin-conjugating enzyme 14 (UBC14)... 120 4e-28 At5g59300.1 68418.m07430 ubiquitin-conjugating enzyme 7 (UBC7) E... 109 1e-24 At3g08690.1 68416.m01010 ubiquitin-conjugating enzyme 11 (UBC11)... 89 2e-18 At5g56150.2 68418.m07005 ubiquitin-conjugating enzyme, putative ... 87 5e-18 At5g56150.1 68418.m07004 ubiquitin-conjugating enzyme, putative ... 87 5e-18 At1g64230.1 68414.m07276 ubiquitin-conjugating enzyme, putative ... 87 7e-18 At4g27960.2 68417.m04012 ubiquitin-conjugating enzyme E2-17 kDa ... 87 9e-18 At4g27960.1 68417.m04011 ubiquitin-conjugating enzyme E2-17 kDa ... 87 9e-18 At2g16740.1 68415.m01920 ubiquitin-conjugating enzyme, putative ... 87 9e-18 At5g41700.4 68418.m05071 ubiquitin-conjugating enzyme 8 (UBC8) E... 85 3e-17 At5g41700.3 68418.m05068 ubiquitin-conjugating enzyme 8 (UBC8) E... 85 3e-17 At5g41700.2 68418.m05070 ubiquitin-conjugating enzyme 8 (UBC8) E... 85 3e-17 At5g41700.1 68418.m05069 ubiquitin-conjugating enzyme 8 (UBC8) E... 85 3e-17 At5g53300.2 68418.m06625 ubiquitin-conjugating enzyme 10 (UBC10)... 85 3e-17 At5g53300.1 68418.m06624 ubiquitin-conjugating enzyme 10 (UBC10)... 85 3e-17 At2g02760.1 68415.m00219 ubiquitin-conjugating enzyme 2 (UBC2) E... 83 1e-16 At1g14400.2 68414.m01708 ubiquitin-conjugating enzyme 1 (UBC1) E... 83 1e-16 At1g14400.1 68414.m01707 ubiquitin-conjugating enzyme 1 (UBC1) E... 83 1e-16 At5g62540.1 68418.m07849 ubiquitin-conjugating enzyme 3 (UBC3) E... 81 3e-16 At3g08700.1 68416.m01011 ubiquitin-conjugating enzyme, putative ... 81 4e-16 At1g36340.1 68414.m04516 ubiquitin-conjugating enzyme family pro... 81 4e-16 At5g25760.1 68418.m03057 ubiquitin-conjugating enzyme, putative ... 79 1e-15 At1g78870.2 68414.m09194 ubiquitin-conjugating enzyme, putative ... 75 3e-14 At1g78870.1 68414.m09193 ubiquitin-conjugating enzyme, putative ... 75 3e-14 At3g13550.1 68416.m01703 ubiquitin-conjugating enzyme (COP10) id... 73 9e-14 At2g32790.1 68415.m04014 ubiquitin-conjugating enzyme, putative ... 73 9e-14 At1g16890.2 68414.m02044 ubiquitin-conjugating enzyme, putative ... 73 9e-14 At5g41340.1 68418.m05024 ubiquitin-conjugating enzyme 4 (UBC4) E... 73 1e-13 At1g63800.1 68414.m07220 ubiquitin-conjugating enzyme 5 (UBC5) E... 72 2e-13 At1g50490.1 68414.m05662 ubiquitin-conjugating enzyme 20 (UBC20)... 71 6e-13 At2g46030.1 68415.m05726 ubiquitin-conjugating enzyme 6 (UBC6) E... 69 2e-12 At1g16890.1 68414.m02043 ubiquitin-conjugating enzyme, putative ... 69 2e-12 At5g50870.1 68418.m06304 ubiquitin-conjugating enzyme, putative ... 68 3e-12 At5g05080.1 68418.m00539 ubiquitin-conjugating enzyme, putative ... 68 4e-12 At3g20060.1 68416.m02537 ubiquitin-conjugating enzyme 19 (UBC19)... 66 1e-11 At1g45050.1 68414.m05165 ubiquitin-conjugating enzyme 15 (UBC15)... 66 1e-11 At1g75440.1 68414.m08763 ubiquitin-conjugating enzyme 16 (UBC16)... 65 2e-11 At3g57870.1 68416.m06451 ubiquitin-conjugating enzyme, putative ... 64 7e-11 At5g42990.1 68418.m05243 ubiquitin-conjugating enzyme 18 (UBC18)... 63 9e-11 At3g24515.1 68416.m03077 ubiquitin-conjugating enzyme, putative ... 62 2e-10 At4g36410.1 68417.m05173 ubiquitin-conjugating enzyme 17 (UBC17)... 62 3e-10 At3g17000.1 68416.m02171 ubiquitin-conjugating enzyme, putative ... 62 3e-10 At2g18600.1 68415.m02166 RUB1-conjugating enzyme, putative stron... 51 4e-07 At2g33770.1 68415.m04141 ubiquitin-conjugating enzyme family pro... 50 1e-06 At2g16920.1 68415.m01949 ubiquitin-conjugating enzyme family pro... 49 2e-06 At1g17280.1 68414.m02105 ubiquitin-conjugating enzyme, putative ... 49 2e-06 At5g50430.1 68418.m06245 ubiquitin-conjugating enzyme, putative ... 48 3e-06 At1g23260.1 68414.m02910 ubiquitin-conjugating enzyme family pro... 45 3e-05 At1g70660.1 68414.m08146 ubiquitin-conjugating enzyme family pro... 42 3e-04 At1g53020.1 68414.m06002 ubiquitin-conjugating enzyme family pro... 40 0.001 At3g52560.1 68416.m05784 ubiquitin-conjugating enzyme family pro... 38 0.004 At3g15355.1 68416.m01945 ubiquitin-conjugating enzyme-related si... 38 0.004 At2g36060.1 68415.m04427 ubiquitin-conjugating enzyme family pro... 38 0.005 At3g52560.2 68416.m05785 ubiquitin-conjugating enzyme family pro... 33 0.085 At2g36060.2 68415.m04428 ubiquitin-conjugating enzyme family pro... 33 0.11 At1g75230.2 68414.m08739 HhH-GPD base excision DNA repair family... 33 0.15 At1g75230.1 68414.m08740 HhH-GPD base excision DNA repair family... 33 0.15 At1g02890.1 68414.m00256 AAA-type ATPase family protein contains... 31 0.34 At1g21160.1 68414.m02646 eukaryotic translation initiation facto... 30 0.80 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 29 1.8 At2g38950.1 68415.m04786 transcription factor jumonji (jmj) fami... 28 4.2 At1g55000.1 68414.m06282 peptidoglycan-binding LysM domain-conta... 28 4.2 At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containi... 27 5.6 At1g55430.1 68414.m06340 DC1 domain-containing protein contains ... 27 5.6 At5g61790.1 68418.m07754 calnexin 1 (CNX1) identical to calnexin... 27 7.4 At5g61620.1 68418.m07732 myb family transcription factor contain... 27 9.8 At4g39850.1 68417.m05646 peroxisomal ABC transporter (PXA1) iden... 27 9.8 At3g16020.1 68416.m02026 hypothetical protein 27 9.8 At2g02680.1 68415.m00207 DC1 domain-containing protein contains ... 27 9.8 >At3g46460.1 68416.m05037 ubiquitin-conjugating enzyme 13 (UBC13) E2; identical to gi:992706 Length = 166 Score = 122 bits (293), Expect = 2e-28 Identities = 48/79 (60%), Positives = 61/79 (77%) Frame = +1 Query: 22 EEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKV 201 + PV+GF L+ E N+FEW V I GPPDTLY+GG+F A M FP +YP SPP++RF + + Sbjct: 18 KHPVDGFSAGLVDEKNIFEWSVTIIGPPDTLYEGGFFYAIMSFPQNYPNSPPTVRFTSDI 77 Query: 202 WHPNVYENGDLCISILHPP 258 WHPNVY +G +CISILHPP Sbjct: 78 WHPNVYPDGRVCISILHPP 96 Score = 65.3 bits (152), Expect = 2e-11 Identities = 30/74 (40%), Positives = 47/74 (63%), Gaps = 1/74 (1%) Frame = +3 Query: 252 PPVDDPQSGELPCERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYRRWRDSKGK- 428 PP DDP EL ERW P +V +++LS+IS+L+ PN SPANV+A+ + WR+ + + Sbjct: 95 PPGDDPSGYELASERWTPVHTVESIMLSIISMLSGPNDESPANVEAA---KEWREKRDEF 151 Query: 429 DKEYENIIRKQAQV 470 K+ +RK ++ Sbjct: 152 KKKVSRCVRKSQEM 165 >At3g55380.1 68416.m06151 ubiquitin-conjugating enzyme 14 (UBC14) E2; UbcAT3; identical to gi:2129757, S46656 Length = 167 Score = 120 bits (290), Expect = 4e-28 Identities = 46/79 (58%), Positives = 63/79 (79%) Frame = +1 Query: 22 EEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKV 201 ++PV+GF L+ E N+F+W V+I GPPDTLY+GG+F A M FP +YP SPP++ F +++ Sbjct: 19 KKPVDGFSAGLVDEKNVFQWSVSIMGPPDTLYEGGFFNAIMSFPENYPVSPPTVTFTSEM 78 Query: 202 WHPNVYENGDLCISILHPP 258 WHPNVY +G +CISILHPP Sbjct: 79 WHPNVYSDGKVCISILHPP 97 Score = 65.7 bits (153), Expect = 2e-11 Identities = 30/74 (40%), Positives = 48/74 (64%), Gaps = 1/74 (1%) Frame = +3 Query: 252 PPVDDPQSGELPCERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYRRWRDSKGK- 428 PP DDP EL ERW P +V +++LS+IS+L+ PN SPANV+A+ + WRD++ + Sbjct: 96 PPGDDPHGYELASERWTPVHTVESIVLSIISMLSGPNDESPANVEAA---KEWRDNRAEF 152 Query: 429 DKEYENIIRKQAQV 470 K+ +R+ ++ Sbjct: 153 RKKVSRCVRRSQEM 166 >At5g59300.1 68418.m07430 ubiquitin-conjugating enzyme 7 (UBC7) E2; identical to gi:992703, SP:P42747 Length = 198 Score = 109 bits (262), Expect = 1e-24 Identities = 42/64 (65%), Positives = 52/64 (81%) Frame = +1 Query: 67 NLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCISI 246 N+FEW V I GPPDTLY+GG+F A M FP +YP SPP++RF + +WHPNVY +G +CISI Sbjct: 65 NIFEWSVTIIGPPDTLYEGGFFNAIMTFPQNYPNSPPTVRFTSDMWHPNVYSDGRVCISI 124 Query: 247 LHPP 258 LHPP Sbjct: 125 LHPP 128 Score = 66.9 bits (156), Expect = 7e-12 Identities = 31/74 (41%), Positives = 47/74 (63%), Gaps = 1/74 (1%) Frame = +3 Query: 252 PPVDDPQSGELPCERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYRRWRDSKGK- 428 PP DDP EL ERW P +V +++LS+IS+L+ PN SPANV+A+ + WRD + + Sbjct: 127 PPGDDPSGYELASERWTPVHTVESIMLSIISMLSGPNDESPANVEAA---KEWRDKRDEF 183 Query: 429 DKEYENIIRKQAQV 470 K+ +RK ++ Sbjct: 184 KKKVSRCVRKSQEM 197 >At3g08690.1 68416.m01010 ubiquitin-conjugating enzyme 11 (UBC11) E2; identical to gi:12643427, SP:P35134 Length = 148 Score = 88.6 bits (210), Expect = 2e-18 Identities = 31/66 (46%), Positives = 44/66 (66%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCIS 243 +++F W+ I GPP++ Y GG F + FPPDYP+ PP + F TKV+HPN+ NG +C+ Sbjct: 28 EDMFHWQATIMGPPESPYAGGVFLVSIHFPPDYPFKPPKVSFKTKVYHPNINSNGSICLD 87 Query: 244 ILHPPW 261 IL W Sbjct: 88 ILKEQW 93 Score = 36.3 bits (80), Expect = 0.012 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYR 404 E+W+P ++ VLLS+ SLL +PN P + + MY+ Sbjct: 91 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK 128 >At5g56150.2 68418.m07005 ubiquitin-conjugating enzyme, putative strong similarity to ubiquitin-conjugating enzyme UBC2 [Mesembryanthemum crystallinum] GI:5762457, UBC4 [Pisum sativum] GI:456568; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 87.4 bits (207), Expect = 5e-18 Identities = 31/66 (46%), Positives = 44/66 (66%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCIS 243 D++F+W+ I GP D+ + GG F + FPPDYP+ PP + F TKV+HPN+ NG +C+ Sbjct: 28 DDMFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINSNGSICLD 87 Query: 244 ILHPPW 261 IL W Sbjct: 88 ILKEQW 93 Score = 35.1 bits (77), Expect = 0.028 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYR 404 E+W+P +V VLLS+ SLL +PN P + + +Y+ Sbjct: 91 EQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHIYK 128 >At5g56150.1 68418.m07004 ubiquitin-conjugating enzyme, putative strong similarity to ubiquitin-conjugating enzyme UBC2 [Mesembryanthemum crystallinum] GI:5762457, UBC4 [Pisum sativum] GI:456568; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 87.4 bits (207), Expect = 5e-18 Identities = 31/66 (46%), Positives = 44/66 (66%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCIS 243 D++F+W+ I GP D+ + GG F + FPPDYP+ PP + F TKV+HPN+ NG +C+ Sbjct: 28 DDMFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINSNGSICLD 87 Query: 244 ILHPPW 261 IL W Sbjct: 88 ILKEQW 93 Score = 35.1 bits (77), Expect = 0.028 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYR 404 E+W+P +V VLLS+ SLL +PN P + + +Y+ Sbjct: 91 EQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHIYK 128 >At1g64230.1 68414.m07276 ubiquitin-conjugating enzyme, putative identical or nearly so to Ubiquitin-conjugating enzymes SP|P35132, SP|P35131, SP|P35133 from {Arabidopsis thaliana}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 87.0 bits (206), Expect = 7e-18 Identities = 32/66 (48%), Positives = 43/66 (65%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCIS 243 +++F W+ I GP D+ Y GG F + FPPDYP+ PP + F TKV+HPNV NG +C+ Sbjct: 28 EDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLD 87 Query: 244 ILHPPW 261 IL W Sbjct: 88 ILKEQW 93 Score = 36.3 bits (80), Expect = 0.012 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYR 404 E+W+P ++ VLLS+ SLL +PN P + + MY+ Sbjct: 91 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK 128 >At4g27960.2 68417.m04012 ubiquitin-conjugating enzyme E2-17 kDa 9 (UBC9) E2; identical to gi:297883, SP:P35132; identical to cDNA UBC9 for ubiquitin conjugating enzyme homolog GI:297883 Length = 178 Score = 86.6 bits (205), Expect = 9e-18 Identities = 31/66 (46%), Positives = 43/66 (65%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCIS 243 +++F W+ I GP D+ Y GG F + FPPDYP+ PP + F TKV+HPN+ NG +C+ Sbjct: 58 EDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLD 117 Query: 244 ILHPPW 261 IL W Sbjct: 118 ILKEQW 123 Score = 36.3 bits (80), Expect = 0.012 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYR 404 E+W+P ++ VLLS+ SLL +PN P + + MY+ Sbjct: 121 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK 158 >At4g27960.1 68417.m04011 ubiquitin-conjugating enzyme E2-17 kDa 9 (UBC9) E2; identical to gi:297883, SP:P35132; identical to cDNA UBC9 for ubiquitin conjugating enzyme homolog GI:297883 Length = 148 Score = 86.6 bits (205), Expect = 9e-18 Identities = 31/66 (46%), Positives = 43/66 (65%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCIS 243 +++F W+ I GP D+ Y GG F + FPPDYP+ PP + F TKV+HPN+ NG +C+ Sbjct: 28 EDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLD 87 Query: 244 ILHPPW 261 IL W Sbjct: 88 ILKEQW 93 Score = 36.3 bits (80), Expect = 0.012 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYR 404 E+W+P ++ VLLS+ SLL +PN P + + MY+ Sbjct: 91 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK 128 >At2g16740.1 68415.m01920 ubiquitin-conjugating enzyme, putative strong similarity to SP|P35133 Ubiquitin-conjugating enzyme E2-17 kDa 10 (EC 6.3.2.19) (Ubiquitin- protein ligase 10) (Ubiquitin carrier protein 10) {Arabidopsis thaliana}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 86.6 bits (205), Expect = 9e-18 Identities = 33/68 (48%), Positives = 46/68 (67%) Frame = +1 Query: 58 GEDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLC 237 GED +F W+ I GP ++ Y GG F ++ FPPDYP+ PP + F TKV+HPN+ NG++C Sbjct: 27 GED-MFHWQATIMGPNESPYSGGVFLVNIHFPPDYPFKPPKVVFRTKVFHPNINSNGNIC 85 Query: 238 ISILHPPW 261 + IL W Sbjct: 86 LDILKDQW 93 Score = 33.5 bits (73), Expect = 0.085 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYR 404 ++W+P ++ VLLS+ SLL +PN P + + +Y+ Sbjct: 91 DQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHIYK 128 >At5g41700.4 68418.m05071 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 149 Score = 85.0 bits (201), Expect = 3e-17 Identities = 30/66 (45%), Positives = 43/66 (65%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCIS 243 +++F W+ I GP ++ Y GG F + FPPDYP+ PP + F TKV+HPN+ NG +C+ Sbjct: 29 EDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLD 88 Query: 244 ILHPPW 261 IL W Sbjct: 89 ILKEQW 94 Score = 36.3 bits (80), Expect = 0.012 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYR 404 E+W+P ++ VLLS+ SLL +PN P + + MY+ Sbjct: 92 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK 129 >At5g41700.3 68418.m05068 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 145 Score = 85.0 bits (201), Expect = 3e-17 Identities = 30/66 (45%), Positives = 43/66 (65%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCIS 243 +++F W+ I GP ++ Y GG F + FPPDYP+ PP + F TKV+HPN+ NG +C+ Sbjct: 28 EDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLD 87 Query: 244 ILHPPW 261 IL W Sbjct: 88 ILKEQW 93 >At5g41700.2 68418.m05070 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 148 Score = 85.0 bits (201), Expect = 3e-17 Identities = 30/66 (45%), Positives = 43/66 (65%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCIS 243 +++F W+ I GP ++ Y GG F + FPPDYP+ PP + F TKV+HPN+ NG +C+ Sbjct: 28 EDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLD 87 Query: 244 ILHPPW 261 IL W Sbjct: 88 ILKEQW 93 Score = 36.3 bits (80), Expect = 0.012 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYR 404 E+W+P ++ VLLS+ SLL +PN P + + MY+ Sbjct: 91 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK 128 >At5g41700.1 68418.m05069 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 148 Score = 85.0 bits (201), Expect = 3e-17 Identities = 30/66 (45%), Positives = 43/66 (65%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCIS 243 +++F W+ I GP ++ Y GG F + FPPDYP+ PP + F TKV+HPN+ NG +C+ Sbjct: 28 EDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLD 87 Query: 244 ILHPPW 261 IL W Sbjct: 88 ILKEQW 93 Score = 36.3 bits (80), Expect = 0.012 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYR 404 E+W+P ++ VLLS+ SLL +PN P + + MY+ Sbjct: 91 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK 128 >At5g53300.2 68418.m06625 ubiquitin-conjugating enzyme 10 (UBC10) E2; identical to gi:297877, SP:P35133 Length = 148 Score = 84.6 bits (200), Expect = 3e-17 Identities = 30/66 (45%), Positives = 43/66 (65%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCIS 243 +++F W+ I GP ++ Y GG F + FPPDYP+ PP + F TKV+HPN+ NG +C+ Sbjct: 28 EDMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLD 87 Query: 244 ILHPPW 261 IL W Sbjct: 88 ILKEQW 93 Score = 36.3 bits (80), Expect = 0.012 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYR 404 E+W+P ++ VLLS+ SLL +PN P + + MY+ Sbjct: 91 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK 128 >At5g53300.1 68418.m06624 ubiquitin-conjugating enzyme 10 (UBC10) E2; identical to gi:297877, SP:P35133 Length = 148 Score = 84.6 bits (200), Expect = 3e-17 Identities = 30/66 (45%), Positives = 43/66 (65%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCIS 243 +++F W+ I GP ++ Y GG F + FPPDYP+ PP + F TKV+HPN+ NG +C+ Sbjct: 28 EDMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLD 87 Query: 244 ILHPPW 261 IL W Sbjct: 88 ILKEQW 93 Score = 36.3 bits (80), Expect = 0.012 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYR 404 E+W+P ++ VLLS+ SLL +PN P + + MY+ Sbjct: 91 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK 128 >At2g02760.1 68415.m00219 ubiquitin-conjugating enzyme 2 (UBC2) E2; identical to gi:2689242, SP:P42745 Length = 152 Score = 83.0 bits (196), Expect = 1e-16 Identities = 29/67 (43%), Positives = 46/67 (68%) Frame = +1 Query: 61 EDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCI 240 ++N+ W IFGP DT + GG FK ++F DYP PP++RF+++++HPN+Y +G +C+ Sbjct: 30 DNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICL 89 Query: 241 SILHPPW 261 IL W Sbjct: 90 DILQNQW 96 Score = 37.1 bits (82), Expect = 0.007 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +3 Query: 294 RWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMY 401 +W+P V +L S+ SLL +PN SPAN +A+ M+ Sbjct: 95 QWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMF 130 >At1g14400.2 68414.m01708 ubiquitin-conjugating enzyme 1 (UBC1) E2; identical to gi:431259, SP:P25865 Length = 152 Score = 83.0 bits (196), Expect = 1e-16 Identities = 29/67 (43%), Positives = 46/67 (68%) Frame = +1 Query: 61 EDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCI 240 ++N+ W IFGP DT + GG FK ++F DYP PP++RF+++++HPN+Y +G +C+ Sbjct: 30 DNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICL 89 Query: 241 SILHPPW 261 IL W Sbjct: 90 DILQNQW 96 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/36 (47%), Positives = 24/36 (66%) Frame = +3 Query: 294 RWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMY 401 +W+P V +L S+ SLL +PN SPAN +A+ MY Sbjct: 95 QWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMY 130 >At1g14400.1 68414.m01707 ubiquitin-conjugating enzyme 1 (UBC1) E2; identical to gi:431259, SP:P25865 Length = 152 Score = 83.0 bits (196), Expect = 1e-16 Identities = 29/67 (43%), Positives = 46/67 (68%) Frame = +1 Query: 61 EDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCI 240 ++N+ W IFGP DT + GG FK ++F DYP PP++RF+++++HPN+Y +G +C+ Sbjct: 30 DNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICL 89 Query: 241 SILHPPW 261 IL W Sbjct: 90 DILQNQW 96 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/36 (47%), Positives = 24/36 (66%) Frame = +3 Query: 294 RWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMY 401 +W+P V +L S+ SLL +PN SPAN +A+ MY Sbjct: 95 QWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMY 130 >At5g62540.1 68418.m07849 ubiquitin-conjugating enzyme 3 (UBC3) E2; identical to gi:431261, SP:P42746 Length = 150 Score = 81.4 bits (192), Expect = 3e-16 Identities = 29/67 (43%), Positives = 44/67 (65%) Frame = +1 Query: 61 EDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCI 240 ++N+ W IFGP DT + GG FK + F DYP PP +RF+++++HPN+Y +G +C+ Sbjct: 30 DNNIMHWNALIFGPEDTPWDGGTFKLTLHFTEDYPNKPPIVRFVSRMFHPNIYADGSICL 89 Query: 241 SILHPPW 261 IL W Sbjct: 90 DILQNQW 96 Score = 37.1 bits (82), Expect = 0.007 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +3 Query: 294 RWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMY 401 +W+P V VL S+ SLL +PN SPAN +A+ ++ Sbjct: 95 QWSPIYDVAAVLTSIQSLLCDPNPDSPANAEAARLF 130 >At3g08700.1 68416.m01011 ubiquitin-conjugating enzyme, putative strong similar to ubiquitin-conjugating enzymes E2-17 from [Arabidopsis thaliana] SP|P35134, SP|P35132, SP|P35133; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 149 Score = 81.0 bits (191), Expect = 4e-16 Identities = 29/69 (42%), Positives = 42/69 (60%) Frame = +1 Query: 55 LGEDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDL 234 + E+++F W+ I GP D+ Y GG F + F DYP+ PP + F TKV+HPN+ G + Sbjct: 26 VAEEDIFHWQATIMGPHDSPYSGGVFTVSIDFSSDYPFKPPKVNFKTKVYHPNIDSKGSI 85 Query: 235 CISILHPPW 261 C+ IL W Sbjct: 86 CLDILKEQW 94 Score = 34.3 bits (75), Expect = 0.049 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYR 404 E+W+P + VLLS+ SLL +PN P + + +Y+ Sbjct: 92 EQWSPAPTTSKVLLSICSLLTDPNPNDPLVPEIAHLYK 129 >At1g36340.1 68414.m04516 ubiquitin-conjugating enzyme family protein similar to Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) from {Schizosaccharomyces pombe} SP|P46595, {Caenorhabditis elegans} SP|P35129; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 154 Score = 81.0 bits (191), Expect = 4e-16 Identities = 29/66 (43%), Positives = 42/66 (63%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCIS 243 +N++EW I GP T Y+GG F +KFP DYP+ PP F T ++HPN+ + G +C++ Sbjct: 34 NNIYEWTAVIRGPDGTPYEGGMFNLSIKFPTDYPFKPPKFTFKTPIYHPNINDEGSICMN 93 Query: 244 ILHPPW 261 IL W Sbjct: 94 ILKDKW 99 Score = 31.1 bits (67), Expect = 0.46 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYRRWR 413 ++W P V VLLS++ LL +PN P + +++ R Sbjct: 97 DKWTPALMVEKVLLSILLLLEKPNPDDPLVPEIGQLFKNNR 137 >At5g25760.1 68418.m03057 ubiquitin-conjugating enzyme, putative similar to SP|O60015 Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) {Pichia angusta}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 157 Score = 79.4 bits (187), Expect = 1e-15 Identities = 34/83 (40%), Positives = 52/83 (62%), Gaps = 2/83 (2%) Frame = +1 Query: 19 REEPVEGFRVKLLGED-NLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLT 195 + E V ++L+ +D N+F+W I GP +T Y+GG F+ P YP PP +RFLT Sbjct: 16 QREKVADPDIQLICDDTNIFKWTALIKGPSETPYEGGVFQLAFSVPEPYPLQPPQVRFLT 75 Query: 196 KVWHPNV-YENGDLCISILHPPW 261 K++HPNV ++ G++C+ IL W Sbjct: 76 KIFHPNVHFKTGEICLDILKNAW 98 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +3 Query: 297 WNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYR 404 W+P ++++V ++I+L+ P SP N D+ + R Sbjct: 98 WSPAWTLQSVCRAIIALMAHPEPDSPLNCDSGNLLR 133 >At1g78870.2 68414.m09194 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 153 Score = 74.9 bits (176), Expect = 3e-14 Identities = 32/79 (40%), Positives = 46/79 (58%) Frame = +1 Query: 25 EPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVW 204 EP G EDN+ + V I GP + Y+GG FK + P +YP + P +RFLTK++ Sbjct: 20 EPAPGISASP-SEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIY 78 Query: 205 HPNVYENGDLCISILHPPW 261 HPN+ + G +C+ IL W Sbjct: 79 HPNIDKLGRICLDILKDKW 97 Score = 35.1 bits (77), Expect = 0.028 Identities = 14/46 (30%), Positives = 29/46 (63%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYRRWRDSKGK 428 ++W+P +RTVLLS+ +LL+ PN P + + + + W+ ++ + Sbjct: 95 DKWSPALQIRTVLLSIQALLSAPNPDDPLSENIA---KHWKSNEAE 137 >At1g78870.1 68414.m09193 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 112 Score = 74.9 bits (176), Expect = 3e-14 Identities = 32/79 (40%), Positives = 46/79 (58%) Frame = +1 Query: 25 EPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVW 204 EP G EDN+ + V I GP + Y+GG FK + P +YP + P +RFLTK++ Sbjct: 20 EPAPGISASP-SEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIY 78 Query: 205 HPNVYENGDLCISILHPPW 261 HPN+ + G +C+ IL W Sbjct: 79 HPNIDKLGRICLDILKDKW 97 >At3g13550.1 68416.m01703 ubiquitin-conjugating enzyme (COP10) identical to ubiquitin-conjugating enzyme COP10 [Arabidopsis thaliana] GI:20065779; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 182 Score = 73.3 bits (172), Expect = 9e-14 Identities = 30/66 (45%), Positives = 40/66 (60%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCIS 243 DNL+ W I GP T Y+GG F + FP DYP+ PP + F T+++H NV GDL ++ Sbjct: 63 DNLYHWIATIIGPSGTPYEGGIFFLDIIFPSDYPFKPPKLVFKTRIYHCNVDTAGDLSVN 122 Query: 244 ILHPPW 261 IL W Sbjct: 123 ILRDSW 128 >At2g32790.1 68415.m04014 ubiquitin-conjugating enzyme, putative similar to ubiquitin conjugating enzyme from [Oryza sativa] GI:1373001, {Arabidopsis thaliana} SP|P35134, SP|P35131; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 177 Score = 73.3 bits (172), Expect = 9e-14 Identities = 28/66 (42%), Positives = 39/66 (59%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCIS 243 +N+F WE + GP Y+ G F + PP YPY PP I F TK++HPN+ E G++ + Sbjct: 57 ENIFRWEATVNGPVGCPYEKGVFTVSVHIPPKYPYEPPKITFKTKIFHPNISEIGEIFVD 116 Query: 244 ILHPPW 261 IL W Sbjct: 117 ILGSRW 122 >At1g16890.2 68414.m02044 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 153 Score = 73.3 bits (172), Expect = 9e-14 Identities = 31/79 (39%), Positives = 46/79 (58%) Frame = +1 Query: 25 EPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVW 204 EP G E+N+ + V I GP + Y+GG FK + P +YP + P +RFLTK++ Sbjct: 20 EPAPGISASP-SEENMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIY 78 Query: 205 HPNVYENGDLCISILHPPW 261 HPN+ + G +C+ IL W Sbjct: 79 HPNIDKLGRICLDILKDKW 97 Score = 35.5 bits (78), Expect = 0.021 Identities = 15/49 (30%), Positives = 30/49 (61%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYRRWRDSKGKDKE 437 ++W+P +RTVLLS+ +LL+ PN P + + + + W+ ++ + E Sbjct: 95 DKWSPALQIRTVLLSIQALLSAPNPDDPLSENIA---KHWKSNEAEAVE 140 >At5g41340.1 68418.m05024 ubiquitin-conjugating enzyme 4 (UBC4) E2; identical to gi:431265, SP:P42748 Length = 187 Score = 72.9 bits (171), Expect = 1e-13 Identities = 29/67 (43%), Positives = 45/67 (67%), Gaps = 1/67 (1%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYE-NGDLCI 240 D + E+ V GP D+LYQGG +K ++ P YPY PS+ F+TK++HPNV E +G +C+ Sbjct: 27 DGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYPYKSPSVGFITKIYHPNVDELSGSVCL 86 Query: 241 SILHPPW 261 +++ W Sbjct: 87 DVINQTW 93 >At1g63800.1 68414.m07220 ubiquitin-conjugating enzyme 5 (UBC5) E2; identical to gi:431269, SP:P42749 Length = 185 Score = 72.1 bits (169), Expect = 2e-13 Identities = 28/75 (37%), Positives = 51/75 (68%), Gaps = 1/75 (1%) Frame = +1 Query: 40 FRVKLLGEDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVY 219 ++V+++ D + E+ V GP D++Y+GG +K ++ P YPY PS+ F+TK++HPNV Sbjct: 20 YKVEMIN-DGMQEFFVEFSGPKDSIYEGGVWKIRVELPDAYPYKSPSVGFITKIYHPNVD 78 Query: 220 E-NGDLCISILHPPW 261 E +G +C+ +++ W Sbjct: 79 EMSGSVCLDVINQTW 93 >At1g50490.1 68414.m05662 ubiquitin-conjugating enzyme 20 (UBC20) nearly identical to ubiquitin-conjugating enzyme UBC20 [Arabidopsis thaliana] GI:22530867; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 180 Score = 70.5 bits (165), Expect = 6e-13 Identities = 27/67 (40%), Positives = 42/67 (62%) Frame = +1 Query: 61 EDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCI 240 EDN+F W+ I G DT+++G ++ + F DYP+ PP ++F T +HPNV G++C+ Sbjct: 61 EDNIFCWKGTITGSKDTVFEGTEYRLSLSFSNDYPFKPPKVKFETCCFHPNVDVYGNICL 120 Query: 241 SILHPPW 261 IL W Sbjct: 121 DILQDKW 127 Score = 41.5 bits (93), Expect = 3e-04 Identities = 17/37 (45%), Positives = 25/37 (67%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMY 401 ++W+ VRT+LLS+ SLL EPN SP N A+ ++ Sbjct: 125 DKWSSAYDVRTILLSIQSLLGEPNISSPLNTQAAQLW 161 >At2g46030.1 68415.m05726 ubiquitin-conjugating enzyme 6 (UBC6) E2; identical to gi|431267, SP:P42750, PIR:S52661; contains a ubiquitin-conjugating enzymes active site (PDOC00163) Length = 183 Score = 68.9 bits (161), Expect = 2e-12 Identities = 28/67 (41%), Positives = 44/67 (65%), Gaps = 1/67 (1%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYE-NGDLCI 240 D+L + V GP D+LYQGG +K ++ P YPY PS+ F+ K++HPNV E +G +C+ Sbjct: 27 DDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYPYKSPSVGFVNKIYHPNVDESSGAVCL 86 Query: 241 SILHPPW 261 +++ W Sbjct: 87 DVINQTW 93 >At1g16890.1 68414.m02043 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 120 Score = 68.5 bits (160), Expect = 2e-12 Identities = 26/61 (42%), Positives = 39/61 (63%) Frame = +1 Query: 79 WEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCISILHPP 258 + V I GP + Y+GG FK + P +YP + P +RFLTK++HPN+ + G +C+ IL Sbjct: 4 FNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDK 63 Query: 259 W 261 W Sbjct: 64 W 64 Score = 35.5 bits (78), Expect = 0.021 Identities = 15/49 (30%), Positives = 30/49 (61%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYRRWRDSKGKDKE 437 ++W+P +RTVLLS+ +LL+ PN P + + + + W+ ++ + E Sbjct: 62 DKWSPALQIRTVLLSIQALLSAPNPDDPLSENIA---KHWKSNEAEAVE 107 >At5g50870.1 68418.m06304 ubiquitin-conjugating enzyme, putative strong similarity to ubiquitin conjugating enzyme [Lycopersicon esculentum] GI:886679; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 192 Score = 68.1 bits (159), Expect = 3e-12 Identities = 33/82 (40%), Positives = 45/82 (54%), Gaps = 1/82 (1%) Frame = +1 Query: 19 REEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTK 198 R + G RV DNL I GP T Y+GG F+ + P YP+ PP ++F TK Sbjct: 16 RNQDSSGIRV-CPKSDNLTRLTGTIPGPIGTPYEGGTFQIDITMPDGYPFEPPKMQFSTK 74 Query: 199 VWHPNV-YENGDLCISILHPPW 261 VWHPN+ ++G +C+ IL W Sbjct: 75 VWHPNISSQSGAICLDILKDQW 96 >At5g05080.1 68418.m00539 ubiquitin-conjugating enzyme, putative similar to SP|Q16763 Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier protein) {Homo sapiens}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 251 Score = 67.7 bits (158), Expect = 4e-12 Identities = 29/83 (34%), Positives = 49/83 (59%) Frame = +1 Query: 13 SAREEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFL 192 S E P +G +V ++ +++ + I GP T Y+ G F+ + D+P+SPP F+ Sbjct: 21 SLDESPPDGIKV-VVNDEDFSQICADIEGPVGTPYENGLFRMKLALSHDFPHSPPKGYFM 79 Query: 193 TKVWHPNVYENGDLCISILHPPW 261 TK++HPNV NG++C++ L W Sbjct: 80 TKIFHPNVASNGEICVNTLKKDW 102 >At3g20060.1 68416.m02537 ubiquitin-conjugating enzyme 19 (UBC19) nearly identical to ubiquitin-conjugating enzyme UBC19 [Arabidopsis thaliana] GI:22530865; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 181 Score = 66.5 bits (155), Expect = 1e-11 Identities = 26/67 (38%), Positives = 41/67 (61%) Frame = +1 Query: 61 EDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCI 240 EDN+F W+ I G DT+++G ++ + F DYP+ P ++F T +HPNV G++C+ Sbjct: 62 EDNIFCWKGTITGSKDTVFEGTEYRLSLTFSNDYPFKSPKVKFETCCFHPNVDLYGNICL 121 Query: 241 SILHPPW 261 IL W Sbjct: 122 DILQDKW 128 Score = 40.3 bits (90), Expect = 7e-04 Identities = 17/37 (45%), Positives = 25/37 (67%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMY 401 ++W+ VRT+LLS+ SLL EPN SP N A+ ++ Sbjct: 126 DKWSSAYDVRTILLSIQSLLGEPNISSPLNNQAAQLW 162 >At1g45050.1 68414.m05165 ubiquitin-conjugating enzyme 15 (UBC15) E2; identical to ubiquitin-conjugating enzyme 15 GI:2801442 from [Arabidopsis thaliana] Length = 161 Score = 66.5 bits (155), Expect = 1e-11 Identities = 29/79 (36%), Positives = 45/79 (56%), Gaps = 1/79 (1%) Frame = +1 Query: 28 PVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKV-W 204 P GFR K+ DNL +W + + G P TLY ++ ++FP YP P + F++ Sbjct: 31 PPTGFRHKVT--DNLQKWTIDVTGAPGTLYANETYQLQVEFPEHYPMEAPQVVFVSPAPS 88 Query: 205 HPNVYENGDLCISILHPPW 261 HP++Y NG +C+ IL+ W Sbjct: 89 HPHIYSNGHICLDILYDSW 107 >At1g75440.1 68414.m08763 ubiquitin-conjugating enzyme 16 (UBC16) E2; identical to gi:2801444, GB:AAC39325 from [Arabidopsis thaliana] (Plant Mol. Biol. 23 (2), 387-396 (1993)) Length = 161 Score = 65.3 bits (152), Expect = 2e-11 Identities = 29/79 (36%), Positives = 42/79 (53%), Gaps = 1/79 (1%) Frame = +1 Query: 28 PVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKV-W 204 P GF+ K+ DNL W + + G P TLY ++ + FP YP P + FL Sbjct: 31 PPTGFKHKVT--DNLQRWIIEVIGAPGTLYANDTYQLQVDFPEHYPMESPQVIFLHPAPL 88 Query: 205 HPNVYENGDLCISILHPPW 261 HP++Y NG +C+ IL+ W Sbjct: 89 HPHIYSNGHICLDILYDSW 107 >At3g57870.1 68416.m06451 ubiquitin-conjugating enzyme, putative strong similarity to SP|P50550 Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO- 1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) {Xenopus laevis}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 160 Score = 63.7 bits (148), Expect = 7e-11 Identities = 28/65 (43%), Positives = 37/65 (56%) Frame = +1 Query: 58 GEDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLC 237 G NL W I G T ++GG+F M F DYP PP +F +HPNVY +G +C Sbjct: 35 GTVNLMVWHCTIPGKAGTDWEGGFFPLTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVC 94 Query: 238 ISILH 252 +SIL+ Sbjct: 95 LSILN 99 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 297 WNPTQSVRTVLLSVISLLNEPNTFSPANVD 386 W P +V+ +L+ + LL+ PN PA D Sbjct: 104 WRPAITVKQILVGIQDLLDTPNPADPAQTD 133 >At5g42990.1 68418.m05243 ubiquitin-conjugating enzyme 18 (UBC18) E2; identical to gi:2801448 Length = 161 Score = 63.3 bits (147), Expect = 9e-11 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 1/79 (1%) Frame = +1 Query: 28 PVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKV-W 204 P GF+ ++ DNL +W + + G P TLY + ++FP YP P + F+ Sbjct: 31 PPTGFKHRVT--DNLQKWVIEVTGAPGTLYANETYNLQVEFPQHYPMEAPQVIFVPPAPL 88 Query: 205 HPNVYENGDLCISILHPPW 261 HP++Y NG +C+ IL+ W Sbjct: 89 HPHIYSNGHICLDILYDSW 107 >At3g24515.1 68416.m03077 ubiquitin-conjugating enzyme, putative similar to Ubiquitin-conjugating enzyme E2 (Ubiquitin-protein ligase) (Ubiquitin carrier protein) from {Xenopus laevis} SP|P51669, {Schizosaccharomyces pombe} SP|P46595, {Caenorhabditis elegans} SP|P35129; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 409 Score = 62.1 bits (144), Expect = 2e-10 Identities = 23/59 (38%), Positives = 36/59 (61%) Frame = +1 Query: 82 EVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCISILHPP 258 + I GP DT+Y G F ++ P YP+ PP + F T ++HPN+ +G +C+ IL+ P Sbjct: 48 DAQIEGPEDTVYANGIFNLKIQIPERYPFQPPIVSFATPIYHPNIDNSGRICLDILNLP 106 Score = 28.3 bits (60), Expect = 3.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 285 PCERWNPTQSVRTVLLSVISLLNEPN 362 P W P+ ++ TVL S+ LL+EPN Sbjct: 107 PKGAWQPSLNISTVLTSMRLLLSEPN 132 >At4g36410.1 68417.m05173 ubiquitin-conjugating enzyme 17 (UBC17) E2; identical to gi:2801446 Length = 161 Score = 61.7 bits (143), Expect = 3e-10 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 1/79 (1%) Frame = +1 Query: 28 PVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKV-W 204 P GF+ ++ DNL W + + G P TLY ++ ++FP YP P + F Sbjct: 31 PPSGFKHRV--SDNLQRWIIEVHGVPGTLYANETYQLQVEFPEHYPMEAPQVIFQHPAPL 88 Query: 205 HPNVYENGDLCISILHPPW 261 HP++Y NG +C+ +L+ W Sbjct: 89 HPHIYSNGHICLDVLYDSW 107 >At3g17000.1 68416.m02171 ubiquitin-conjugating enzyme, putative similar to Non-Canonical UBiquitin Conjugating Enzyme 1 (NCUBE1) from [Gallus gallus] GI:7362937, [Mus musculus] GI:7363050, [Homo sapiens] GI:7362973; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 309 Score = 61.7 bits (143), Expect = 3e-10 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 2/67 (2%) Frame = +1 Query: 61 EDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCI 240 E+N+FEW+ AI GP DT ++GG + ++ P DYP+ PPS LT + N +C+ Sbjct: 37 EENIFEWQFAIRGPGDTEFEGGIYHGRIQLPADYPFKPPSFMLLTP--NGRFETNTKICL 94 Query: 241 SI--LHP 255 SI HP Sbjct: 95 SISNYHP 101 Score = 26.6 bits (56), Expect = 9.8 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLL-NEPN 362 E W P+ SVRT L+++I+ + PN Sbjct: 102 EHWQPSWSVRTALVALIAFMPTSPN 126 >At2g18600.1 68415.m02166 RUB1-conjugating enzyme, putative strong similarity to gi:6635457 RUB1 conjugating enzyme [Arabidopsis thaliana]; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 185 Score = 51.2 bits (117), Expect = 4e-07 Identities = 23/68 (33%), Positives = 38/68 (55%) Frame = +1 Query: 58 GEDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLC 237 G+++L +EV I P + Y G F + YP+ P ++ TKV+HPN+ G++C Sbjct: 56 GKNDLMNFEVTI-KPDEGYYLSGNFVFSFQVSNMYPHEAPKVKCKTKVYHPNIDLEGNVC 114 Query: 238 ISILHPPW 261 ++IL W Sbjct: 115 LNILREDW 122 Score = 32.7 bits (71), Expect = 0.15 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 291 ERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYR 404 E W P ++ TV+ + L EPN P N +A+ + R Sbjct: 120 EDWKPVLNINTVIYGLFHLFTEPNYEDPLNHEAAAVLR 157 >At2g33770.1 68415.m04141 ubiquitin-conjugating enzyme family protein low similarity to ubiquitin-conjugating BIR-domain enzyme APOLLON [Homo sapiens] GI:8489831, ubiquitin-conjugating enzyme [Mus musculus] GI:3319990; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 907 Score = 49.6 bits (113), Expect = 1e-06 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 2/66 (3%) Frame = +1 Query: 61 EDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLT--KVWHPNVYENGDL 234 E+ + A+ G P T Y G F + PP YP+ PP + + + +PN+YE+G + Sbjct: 688 EERMDLLRAALVGAPGTPYHDGLFFFDIMLPPQYPHEPPMVHYHSGGMRLNPNLYESGRV 747 Query: 235 CISILH 252 C+S+L+ Sbjct: 748 CLSLLN 753 >At2g16920.1 68415.m01949 ubiquitin-conjugating enzyme family protein low similarity to ubiquitin-conjugating BIR-domain enzyme APOLLON [Homo sapiens] GI:8489831, ubiquitin-conjugating enzyme [Mus musculus] GI:3319990; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 1102 Score = 48.8 bits (111), Expect = 2e-06 Identities = 25/66 (37%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = +1 Query: 61 EDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVW--HPNVYENGDL 234 ED + I G T YQ G F P DYP PPS + + W +PN+YE G + Sbjct: 876 EDRMDLLRAVIVGAFGTPYQDGLFFFDFHLPSDYPSVPPSAYYHSGGWRLNPNLYEEGKV 935 Query: 235 CISILH 252 C+S+L+ Sbjct: 936 CLSLLN 941 >At1g17280.1 68414.m02105 ubiquitin-conjugating enzyme, putative similar to ubiquitin conjugating enzyme 6 from [Homo sapiens] GI:14029267, [Mus musculus] GI:14029263; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 237 Score = 48.8 bits (111), Expect = 2e-06 Identities = 21/64 (32%), Positives = 32/64 (50%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCIS 243 +++ EW + G T + GG++ +KFPP+YPY PP I T + L +S Sbjct: 32 NDILEWHYVLEGSEGTPFAGGFYYGKIKFPPEYPYKPPGITMTTPNGRFMTQKKICLSMS 91 Query: 244 ILHP 255 HP Sbjct: 92 DFHP 95 >At5g50430.1 68418.m06245 ubiquitin-conjugating enzyme, putative similar to ubiquitin conjugating enzyme 6 from [Homo sapiens] GI:14029267, [Mus musculus] GI:14029263; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 243 Score = 48.4 bits (110), Expect = 3e-06 Identities = 17/44 (38%), Positives = 26/44 (59%) Frame = +1 Query: 64 DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLT 195 +++ EW + G T + GG++ +KFPP+YPY PP I T Sbjct: 32 NDILEWHYVLEGSEGTPFAGGFYYGKIKFPPEYPYKPPGITMTT 75 >At1g23260.1 68414.m02910 ubiquitin-conjugating enzyme family protein similar to TRAF6-regulated IKK activator 1 beta Uev1A [Homo sapiens] GI:10880969; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 158 Score = 45.2 bits (102), Expect = 3e-05 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +1 Query: 79 WEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKV 201 W I GPP+T Y+G F+ + +YP SPP++RF T++ Sbjct: 47 WTGTILGPPNTAYEGKIFQLKLFCGKEYPESPPTVRFQTRI 87 >At1g70660.1 68414.m08146 ubiquitin-conjugating enzyme family protein similar to TRAF6-regulated IKK activator 1 beta Uev1A [Homo sapiens] GI:10880969; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 159 Score = 41.5 bits (93), Expect = 3e-04 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +1 Query: 79 WEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKV 201 W I GP +T Y+G F+ + DYP SPP++RF +++ Sbjct: 47 WTGTILGPHNTAYEGKIFQLKLFCGKDYPESPPTVRFQSRI 87 >At1g53020.1 68414.m06002 ubiquitin-conjugating enzyme family protein similar to ubiquitin-conjugating enzyme GB:3319990 from [Mus musculus]; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 1163 Score = 39.5 bits (88), Expect = 0.001 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +1 Query: 91 IFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVW--HPNVYENGDLCISIL 249 I G T Y G F ++FP YP PP++ + + +PN+Y G +C+S+L Sbjct: 307 IIGAEGTPYHDGLFFFDIQFPDTYPSVPPNVHYHSGGLRINPNLYNCGKVCLSLL 361 Score = 38.7 bits (86), Expect = 0.002 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +1 Query: 91 IFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVW--HPNVYENGDLCISIL 249 I G T Y G F ++FP YP PP + + + +PN+Y+ G +C+S++ Sbjct: 641 IIGAEGTPYHDGLFFFDIQFPDTYPSVPPKVHYHSGGLRINPNLYKCGKVCLSLI 695 Score = 34.3 bits (75), Expect = 0.049 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +1 Query: 91 IFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVW--HPNVYENGDLCISI 246 I G T Y G F ++FP YP PP++ + + +PN+Y G + +SI Sbjct: 953 IIGAEGTPYHDGLFFFDIQFPDTYPSVPPNVYYHSGGLRINPNLYNCGKVLVSI 1006 >At3g52560.1 68416.m05784 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 146 Score = 37.9 bits (84), Expect = 0.004 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +1 Query: 79 WEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKV 201 W I GP +T+++G ++ + DYP PP++RF ++V Sbjct: 49 WTGTIIGPHNTVHEGRIYQLKLFCDKDYPEKPPTVRFHSRV 89 >At3g15355.1 68416.m01945 ubiquitin-conjugating enzyme-related similar to ubiquitin-conjugating enzyme (GI:3319990) [Mus musculus]; similar to Baculoviral IAP repeat-containing protein 6 (Ubiquitin-conjugating BIR-domain enzyme apollon) (Swiss-Prot:Q9NR09) [Homo sapiens]; Length = 609 Score = 37.9 bits (84), Expect = 0.004 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 91 IFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVW--HPNVYENGDLCISIL 249 I G T Y G F + FP YP +PP + + + +PN+Y G +C+S+L Sbjct: 368 IIGAQGTPYHDGLFFFDIFFPDTYPSTPPIVHYHSGGLRINPNLYNCGKVCLSLL 422 >At2g36060.1 68415.m04427 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 145 Score = 37.5 bits (83), Expect = 0.005 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = +1 Query: 79 WEVAIFGPPDTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKV 201 W I GP +T+++G ++ + DYP PP++RF +++ Sbjct: 48 WTGTIIGPHNTVHEGRIYQLKLFCDKDYPEKPPTVRFHSRI 88 >At3g52560.2 68416.m05785 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 147 Score = 33.5 bits (73), Expect = 0.085 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +1 Query: 79 WEVAIFGPPD-TLYQGGYFKAHMKFPPDYPYSPPSIRFLTKV 201 W I GP + T+++G ++ + DYP PP++RF ++V Sbjct: 49 WTGTIIGPHNVTVHEGRIYQLKLFCDKDYPEKPPTVRFHSRV 90 >At2g36060.2 68415.m04428 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 146 Score = 33.1 bits (72), Expect = 0.11 Identities = 13/42 (30%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +1 Query: 79 WEVAIFGPPD-TLYQGGYFKAHMKFPPDYPYSPPSIRFLTKV 201 W I GP + T+++G ++ + DYP PP++RF +++ Sbjct: 48 WTGTIIGPHNVTVHEGRIYQLKLFCDKDYPEKPPTVRFHSRI 89 >At1g75230.2 68414.m08739 HhH-GPD base excision DNA repair family protein contains Pfam domain PF00730: HhH-GPD superfamily base excision DNA repair protein Length = 394 Score = 32.7 bits (71), Expect = 0.15 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 1/73 (1%) Frame = +3 Query: 267 PQSGELPCERWNPTQSVRT-VLLSVISLLNEPNTFSPANVDASVMYRRWRDSKGKDKEYE 443 P E CE+W P +SV + L +I N P + A A++ + + D + +++E + Sbjct: 305 PSKMEQLCEKWRPYRSVASWYLWRLIESKNTPPNAAAATAGAALSFPQLEDIQQQEQEQQ 364 Query: 444 NIIRKQAQVARME 482 + +Q Q M+ Sbjct: 365 HQQHQQQQPQLMD 377 >At1g75230.1 68414.m08740 HhH-GPD base excision DNA repair family protein contains Pfam domain PF00730: HhH-GPD superfamily base excision DNA repair protein Length = 391 Score = 32.7 bits (71), Expect = 0.15 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 1/73 (1%) Frame = +3 Query: 267 PQSGELPCERWNPTQSVRT-VLLSVISLLNEPNTFSPANVDASVMYRRWRDSKGKDKEYE 443 P E CE+W P +SV + L +I N P + A A++ + + D + +++E + Sbjct: 305 PSKMEQLCEKWRPYRSVASWYLWRLIESKNTPPNAAAATAGAALSFPQLEDIQQQEQEQQ 364 Query: 444 NIIRKQAQVARME 482 + +Q Q M+ Sbjct: 365 HQQHQQQQPQLMD 377 >At1g02890.1 68414.m00256 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family; similar to mitochondrial sorting protein 1 (MSP1) (TAT-binding homolog 4) (Swiss-Prot:P28737) [Saccharomyces cerevisiae] Length = 1252 Score = 31.5 bits (68), Expect = 0.34 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 1/83 (1%) Frame = +3 Query: 255 PVDDPQSGELPCERWNPTQSVRTVLLSVISLLNEPNTFSPANVDASVMYRRWRDSKGKDK 434 P +P++G +P +P +R +L SLL +P+ F + ++ R+ + K Sbjct: 364 PFQEPEAGNIP----DPAYEIRPIL----SLLGDPSEFDLRGSISKILVDERREVREMPK 415 Query: 435 EYENIIRKQAQV-ARMEAEKEGI 500 EYE R A V R +A K+ + Sbjct: 416 EYE---RPSASVLTRRQAHKDSL 435 >At1g21160.1 68414.m02646 eukaryotic translation initiation factor 2 family protein / eIF-2 family protein similar to SP|O60841 Translation initiation factor IF-2 {Homo sapiens}; contains Pfam profiles PF00009: Elongation factor Tu GTP binding domain, PF03144: Elongation factor Tu domain 2 Length = 1088 Score = 30.3 bits (65), Expect = 0.80 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +3 Query: 405 RWRDSK-GKDKEYENIIRKQAQVARMEAEKE 494 RW++++ GK KE E +RK+ + R+E E+E Sbjct: 231 RWKEAEDGKKKEEEERLRKEEEERRIEEERE 261 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 29.1 bits (62), Expect = 1.8 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 94 FGPPDTLYQGGYFKAHMKFPPDYPYSPP 177 + PP + GGY+ K +YPY+PP Sbjct: 90 YRPPPSSSSGGYYYPPPKSGGNYPYTPP 117 >At2g38950.1 68415.m04786 transcription factor jumonji (jmj) family protein / zinc finger (C5HC2 type) family protein contains Pfam domains, PF02375: jmjN domain, PF02373: jmjC domain and PF02928: C5HC2 zinc finger Length = 708 Score = 27.9 bits (59), Expect = 4.2 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 399 YRRWRDSKGKDKEYENIIRKQAQVARMEAE 488 Y RW DS G D + NII+ + ++ + E Sbjct: 492 YTRWNDSCGTDGLFSNIIKSRIKLEKNRRE 521 >At1g55000.1 68414.m06282 peptidoglycan-binding LysM domain-containing protein contains Pfam profile PF01476: LysM domain Length = 221 Score = 27.9 bits (59), Expect = 4.2 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 196 KVWHPNVYENGDLCISILHPPWMILSLANCPANV 297 KVW+ +V DL +S PW I L PA+V Sbjct: 29 KVWN-SVATEDDLVVSAFTAPWRIKELVGRPASV 61 >At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99615 DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 721 Score = 27.5 bits (58), Expect = 5.6 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -1 Query: 113 SVSGGPKIATSHSNRLSSPSNLTRKPSTGSSRAEFG 6 SV P + S S+ LSS + ++ +T SS A+FG Sbjct: 84 SVQPVPSASKSKSSNLSSAAKSSKSSTTPSSAAQFG 119 >At1g55430.1 68414.m06340 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 657 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/52 (23%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +3 Query: 351 NEPNTFSPANVD--ASVMYRRWRDSKGKDKEYENIIRKQAQVARMEAEKEGI 500 + P TF+ + + AS++++ WRDS ++ E +I + +A + + Sbjct: 88 SHPLTFTALDPEFNASIIHQNWRDSSASEESSEELINEVVDYDHEDAGDDAV 139 >At5g61790.1 68418.m07754 calnexin 1 (CNX1) identical to calnexin homolog 1, Arabidopsis thaliana, EMBL:AT08315 [SP|P29402] Length = 530 Score = 27.1 bits (57), Expect = 7.4 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 121 GGYFKAHMKFPPDYPY 168 G Y + H+KFPP PY Sbjct: 161 GEYVEHHLKFPPSVPY 176 >At5g61620.1 68418.m07732 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 317 Score = 26.6 bits (56), Expect = 9.8 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +1 Query: 142 MKFPPDYPYSPPSIRFLTKVWHPN---VYENGDLCISILHP 255 M++ P Y PP F ++HPN Y N + + +HP Sbjct: 222 MEYMPIYQPIPPYYNFPPIMYHPNYPMYYANPQVPVRFVHP 262 >At4g39850.1 68417.m05646 peroxisomal ABC transporter (PXA1) identical to peroxisomal ABC transporter PXA1 GI:15320529 from [Arabidopsis thaliana]; contains Pfam profile PF00005: ABC transporter; Length = 1337 Score = 26.6 bits (56), Expect = 9.8 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 356 LVEE*DYREEYGANRLCRVPTFAGQFARLRIIHGGW 249 LVE+ R E G+N L P +G+ + R++ G W Sbjct: 463 LVEDLTLRVEQGSNLLITGPNGSGKSSLFRVLGGLW 498 >At3g16020.1 68416.m02026 hypothetical protein Length = 98 Score = 26.6 bits (56), Expect = 9.8 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +1 Query: 190 LTKVWHPNVYENGDLCISILHPPWMILSLANCPANVGTLHNRFAP 324 L K H + E GDL +L + SL + N+ LHN FAP Sbjct: 9 LLKYIHQQLEEKGDLQAIVL----LKYSLYSMSVNIHGLHNDFAP 49 >At2g02680.1 68415.m00207 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 649 Score = 26.6 bits (56), Expect = 9.8 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 168 IRVVRGEFHVCLEVSTLIKCIRRSEDCHF 82 + + G+F +C E +TL IR D H+ Sbjct: 510 LNCIEGDFIICFECATLPYVIRYKHDDHY 538 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,337,178 Number of Sequences: 28952 Number of extensions: 289759 Number of successful extensions: 857 Number of sequences better than 10.0: 70 Number of HSP's better than 10.0 without gapping: 742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 846 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 927799552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -