BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0059.Seq (895 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 6e-13 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 71 2e-12 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 69 7e-12 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 62 4e-10 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 62 6e-10 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 54 1e-07 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 54 1e-07 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 54 1e-07 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 4e-07 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 6e-06 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 42 7e-04 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 9e-04 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 9e-04 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.014 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.014 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.077 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.077 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.077 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 35 0.077 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 35 0.077 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.077 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.41 SB_55415| Best HMM Match : Death (HMM E-Value=1.3e-06) 32 0.54 SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 32 0.54 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 32 0.72 SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.72 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.95 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 31 0.95 SB_38216| Best HMM Match : APOBEC_C (HMM E-Value=7.3) 31 1.7 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_26951| Best HMM Match : CUB (HMM E-Value=0) 31 1.7 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_32285| Best HMM Match : Metallophos (HMM E-Value=2.4e-07) 31 1.7 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_12975| Best HMM Match : Zona_pellucida (HMM E-Value=6.6e-12) 31 1.7 SB_2571| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 30 2.2 SB_57792| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 30 2.9 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 30 2.9 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 30 2.9 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 30 2.9 SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_48121| Best HMM Match : Kelch_1 (HMM E-Value=0.023) 29 3.8 SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_28739| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 29 3.8 SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_55075| Best HMM Match : Keratin_B2 (HMM E-Value=0.46) 26 4.9 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 29 5.1 SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) 29 5.1 SB_56401| Best HMM Match : Moricin (HMM E-Value=5.8) 29 6.7 SB_54947| Best HMM Match : rve (HMM E-Value=2.3e-31) 29 6.7 SB_45174| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_44915| Best HMM Match : VWA (HMM E-Value=0) 29 6.7 SB_43571| Best HMM Match : Ank (HMM E-Value=3e-34) 29 6.7 SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) 29 6.7 SB_41709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_39465| Best HMM Match : PDH (HMM E-Value=1.5) 29 6.7 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 29 6.7 SB_27913| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_23485| Best HMM Match : PsbJ (HMM E-Value=2.4) 29 6.7 SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_16934| Best HMM Match : Ldl_recept_b (HMM E-Value=1.7e-39) 29 6.7 SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_8814| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 29 6.7 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 29 6.7 SB_56291| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_51757| Best HMM Match : Hormone_recep (HMM E-Value=6.4e-37) 29 6.7 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_50538| Best HMM Match : Moricin (HMM E-Value=4.5) 29 6.7 SB_42228| Best HMM Match : Moricin (HMM E-Value=6.6) 29 6.7 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_39908| Best HMM Match : Prismane (HMM E-Value=3) 29 6.7 SB_38217| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_37382| Best HMM Match : Pkinase (HMM E-Value=1e-04) 29 6.7 SB_37193| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) 29 6.7 SB_30214| Best HMM Match : Exo_endo_phos (HMM E-Value=6.1e-11) 29 6.7 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_23924| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_17450| Best HMM Match : RVT_1 (HMM E-Value=2.2e-25) 29 6.7 SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_6719| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) 29 6.7 SB_213| Best HMM Match : rve (HMM E-Value=2.2e-08) 29 6.7 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 28 8.9 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 28 8.9 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 28 8.9 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 28 8.9 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 28 8.9 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 28 8.9 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 28 8.9 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 28 8.9 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 28 8.9 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 28 8.9 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 28 8.9 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 28 8.9 SB_10756| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 28 8.9 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 28 8.9 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 28 8.9 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 28 8.9 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_52095| Best HMM Match : tRNA-synt_2c (HMM E-Value=0) 28 8.9 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 28 8.9 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 28 8.9 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 28 8.9 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 28 8.9 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/58 (60%), Positives = 39/58 (67%) Frame = -3 Query: 893 TFGKGQIVGGLFXLLRXLAKRGMCCKAIKXGXRQXFPKSDVVKRGQLNCNTTHYRANW 720 T GKG G LF + +RGMCCKAIK G + FP DVVKR +NCNTTHYRANW Sbjct: 4 TVGKGDRCG-LFAIT-PAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 72.1 bits (169), Expect = 6e-13 Identities = 30/54 (55%), Positives = 35/54 (64%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIKXGXRQXFPKSDVVKRGQLNCNTTHYRANW 720 G+ +G + +RGMCCKAIK G FP DVVKR +NCNTTHYRANW Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 70.5 bits (165), Expect = 2e-12 Identities = 32/52 (61%), Positives = 35/52 (67%) Frame = -3 Query: 875 IVGGLFXLLRXLAKRGMCCKAIKXGXRQXFPKSDVVKRGQLNCNTTHYRANW 720 I GLF + +RGMCCKAIK G FP DVVKR +NCNTTHYRANW Sbjct: 3 IGAGLFAIT-PAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 68.5 bits (160), Expect = 7e-12 Identities = 28/54 (51%), Positives = 34/54 (62%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIKXGXRQXFPKSDVVKRGQLNCNTTHYRANW 720 G+ +G + +RGMCCK+IK FP DVVKR +NCNTTHYRANW Sbjct: 8 GRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 64.9 bits (151), Expect = 8e-11 Identities = 29/54 (53%), Positives = 34/54 (62%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIKXGXRQXFPKSDVVKRGQLNCNTTHYRANW 720 G+ +G + +RGMCCKAIK FP DVVKR +NCNTTHYRANW Sbjct: 1847 GRAIGAGLFAITPAGERGMCCKAIKL-VTPVFPSHDVVKRRPVNCNTTHYRANW 1899 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 64.1 bits (149), Expect = 1e-10 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = -3 Query: 842 LAKRGMCCKAIKXGXRQXFPKSDVVKRGQLNCNTTHYRAN 723 LA+RGMCCKAIK G F DVVKR +NCNTTHYRAN Sbjct: 1 LAERGMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 62.5 bits (145), Expect = 4e-10 Identities = 27/53 (50%), Positives = 33/53 (62%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIKXGXRQXFPKSDVVKRGQLNCNTTHYRAN 723 G+ +G + +RGMCCKAIK G + FP D KR +NCNTTHYRAN Sbjct: 45 GRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 62.1 bits (144), Expect = 6e-10 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = +3 Query: 720 PIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 PIRPIVSRITI AFYN GK LA T LNRLAAHPPF Sbjct: 39 PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPF 77 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 57.6 bits (133), Expect = 1e-08 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = -3 Query: 881 GQIVG-GLFXLLRXLAKRGMCCKAIKXGXRQXFPKSDVVKRGQLNCNTTHYRANW 720 G+ +G GLF + K + +K G RQ FP DVVKR +NCNTTHYRANW Sbjct: 48 GRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 54.4 bits (125), Expect = 1e-07 Identities = 26/45 (57%), Positives = 29/45 (64%) Frame = -3 Query: 854 LLRXLAKRGMCCKAIKXGXRQXFPKSDVVKRGQLNCNTTHYRANW 720 LLR LAK G + + G FP DVVKR +NCNTTHYRANW Sbjct: 608 LLRQLAKGGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 54.4 bits (125), Expect = 1e-07 Identities = 26/45 (57%), Positives = 29/45 (64%) Frame = -3 Query: 854 LLRXLAKRGMCCKAIKXGXRQXFPKSDVVKRGQLNCNTTHYRANW 720 LLR LAK G + + G FP DVVKR +NCNTTHYRANW Sbjct: 51 LLRQLAKGGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 54.4 bits (125), Expect = 1e-07 Identities = 26/45 (57%), Positives = 29/45 (64%) Frame = -3 Query: 854 LLRXLAKRGMCCKAIKXGXRQXFPKSDVVKRGQLNCNTTHYRANW 720 LLR LAK G + + G FP DVVKR +NCNTTHYRANW Sbjct: 51 LLRQLAKGGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRANW 91 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.8 bits (121), Expect = 4e-07 Identities = 25/45 (55%), Positives = 28/45 (62%) Frame = -3 Query: 854 LLRXLAKRGMCCKAIKXGXRQXFPKSDVVKRGQLNCNTTHYRANW 720 LLR LAK G + + FP DVVKR +NCNTTHYRANW Sbjct: 37 LLRQLAKGGCAARRLSW-VTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.8 bits (111), Expect = 6e-06 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = +3 Query: 738 SRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 SRITI +FYNV GK L+ T LNRLAAHPPF Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPF 34 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 48.4 bits (110), Expect = 8e-06 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -3 Query: 797 RQXFPKSDVVKRGQLNCNTTHYRANW 720 R FP DVVKR +NCNTTHYRANW Sbjct: 55 RSGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 46.8 bits (106), Expect = 2e-05 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -3 Query: 788 FPKSDVVKRGQLNCNTTHYRANW 720 FP DVVKR +NCNTTHYRANW Sbjct: 2 FPSHDVVKRRPVNCNTTHYRANW 24 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 46.8 bits (106), Expect = 2e-05 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -3 Query: 788 FPKSDVVKRGQLNCNTTHYRANW 720 FP DVVKR +NCNTTHYRANW Sbjct: 37 FPSHDVVKRRPVNCNTTHYRANW 59 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +3 Query: 738 SRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 SRITI +FYNV GK T LNRLAAHPPF Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPF 34 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +3 Query: 738 SRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 SRITI +FYNV GK T LNRLAAHPPF Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPF 34 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +3 Query: 738 SRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 SRITI +FYNV GK T LNRLAAHPPF Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPF 34 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 45.2 bits (102), Expect = 7e-05 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +3 Query: 738 SRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 SRITI +FYNV L K T LNRLAAHPPF Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPF 34 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/35 (54%), Positives = 23/35 (65%) Frame = +1 Query: 751 FNWPRFTTSDLGKXWR*PNLIALQHIPLFANXRNN 855 ++WP F GK PNLIALQHIP FA+ RN+ Sbjct: 4 WHWPSFYNDVTGKTLALPNLIALQHIPTFASWRNS 38 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 41.9 bits (94), Expect = 7e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -3 Query: 776 DVVKRGQLNCNTTHYRANW 720 DVVKR +NCNTTHYRANW Sbjct: 3 DVVKRRPVNCNTTHYRANW 21 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 41.9 bits (94), Expect = 7e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -3 Query: 776 DVVKRGQLNCNTTHYRANW 720 DVVKR +NCNTTHYRANW Sbjct: 3 DVVKRRPVNCNTTHYRANW 21 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/38 (57%), Positives = 24/38 (63%) Frame = +3 Query: 723 IRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 IRPIVSRITI +FY + LNRLAAHPPF Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPF 55 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/33 (63%), Positives = 22/33 (66%) Frame = +3 Query: 738 SRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 SRITI +FYNV GK LA L LAAHPPF Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPF 34 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +1 Query: 745 LQFNWPRFTTSDLGKXWR*PNLIALQHIPLFANXRNN 855 + +WP F GK PNLIAL P FA+ RN+ Sbjct: 4 ITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNS 40 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 41.5 bits (93), Expect = 9e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 853 YYASWRKGGCAARRLSXV 800 YYASWRKGGCAARRLS V Sbjct: 76 YYASWRKGGCAARRLSWV 93 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 95 PGFSQSRRCKTTASEL 110 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/37 (51%), Positives = 23/37 (62%) Frame = +1 Query: 745 LQFNWPRFTTSDLGKXWR*PNLIALQHIPLFANXRNN 855 + +WP F GK PNLIALQHIP FA+ RN+ Sbjct: 4 ITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNS 40 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/33 (54%), Positives = 19/33 (57%) Frame = +3 Query: 738 SRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 SRITI +FYNV GK LA L L PPF Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPF 34 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = +3 Query: 762 AFYNV*LGKXLAXTXLNRLAAHPPF 836 +FYNV GK L T LNRLAAHPPF Sbjct: 8 SFYNVVTGKTLGVTQLNRLAAHPPF 32 >SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = +1 Query: 763 RFTTSDLGKXWR*PNLIALQHIPLFANXRNN 855 RFTT GK PNLIALQHIP FA+ RN+ Sbjct: 58 RFTTLVTGKTLALPNLIALQHIPHFASWRNS 88 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/33 (60%), Positives = 22/33 (66%) Frame = +3 Query: 738 SRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 SRITI +FYNV + T LNRLAAHPPF Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPF 34 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/45 (48%), Positives = 25/45 (55%) Frame = -2 Query: 882 RANRWGPFXVITXVGEKGDVLQGD*VXLXPGFSQVRRCKTRPIEL 748 + +R GP KGDVLQG + PGFSQ RRCKT EL Sbjct: 7 KGDRCGPLRYYAS-WRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = +3 Query: 756 LAAFYNV*LGKXLAXTXLNRLAAHPPF 836 LA YNV GK T LNRLAAHPPF Sbjct: 8 LAVVYNVVTGKTPGVTQLNRLAAHPPF 34 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/35 (51%), Positives = 21/35 (60%) Frame = +1 Query: 751 FNWPRFTTSDLGKXWR*PNLIALQHIPLFANXRNN 855 ++WP F GK PNLIALQHIPL RN+ Sbjct: 4 WHWPSFYNVVTGKTLALPNLIALQHIPLSPAGRNS 38 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 37.5 bits (83), Expect = 0.014 Identities = 19/33 (57%), Positives = 20/33 (60%) Frame = +3 Query: 738 SRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 SRITI +FYNV GK LA L L HPPF Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPF 34 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = +1 Query: 745 LQFNWPRFTTSDLGKXWR*PNLIALQHIPLFANXRNN 855 + +WP F GK PNLIALQ P FA+ RN+ Sbjct: 4 ITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNS 40 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.1 bits (82), Expect = 0.019 Identities = 23/53 (43%), Positives = 28/53 (52%) Frame = +3 Query: 723 IRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPFRQLA**PKKAPNDLP 881 +RP+VSRITI +FYNV GK LA L L H P ++A D P Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIAL-QHIPLSPAGVIAEEARTDRP 84 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/45 (46%), Positives = 24/45 (53%) Frame = -2 Query: 882 RANRWGPFXVITXVGEKGDVLQGD*VXLXPGFSQVRRCKTRPIEL 748 + +R GP KGDVLQ + PGFSQ RRCKT EL Sbjct: 7 KGDRCGPLRYYAS-WRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -3 Query: 827 MCCKAIKXGXRQXFPKSDVVKR 762 MCCKAIK G + FP DVVKR Sbjct: 1 MCCKAIKLGNARVFPSHDVVKR 22 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +1 Query: 745 LQFNWPRFTTSDLGKXWR*PNLIALQHIPL 834 + +WP F GK PNLIALQHIPL Sbjct: 4 ITIHWPSFYNVVTGKTLALPNLIALQHIPL 33 Score = 28.3 bits (60), Expect = 8.9 Identities = 20/48 (41%), Positives = 23/48 (47%) Frame = +3 Query: 738 SRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPFRQLA**PKKAPNDLP 881 SRITI +FYNV GK LA L L H P ++A D P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGVNSEEARTDRP 48 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +1 Query: 751 FNWPRFTTSDLGKXWR*PNLIALQHIPL 834 ++WP F GK PNLIALQHIPL Sbjct: 61 WHWPSFYNVVTGKTLALPNLIALQHIPL 88 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +1 Query: 745 LQFNWPRFTTSDLGKXWR*PNLIALQHIPL 834 + +WP F GK PNLIALQHIPL Sbjct: 82 ITIHWPSFYNVVTGKTLALPNLIALQHIPL 111 Score = 30.7 bits (66), Expect = 1.7 Identities = 21/51 (41%), Positives = 25/51 (49%) Frame = +3 Query: 729 PIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPFRQLA**PKKAPNDLP 881 P +SRITI +FYNV GK LA L L H P ++A D P Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGLHREEARTDRP 126 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 35.1 bits (77), Expect = 0.077 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIKXGXRQXFP 783 G+ +G + +RGMCCKAIK G + FP Sbjct: 21 GRAIGAGLFAITPAGERGMCCKAIKLGNARVFP 53 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +1 Query: 745 LQFNWPRFTTSDLGKXWR*PNLIALQHIPL 834 + +WP F GK PNLIALQHIPL Sbjct: 4 ITIHWPSFYNVVTGKTLALPNLIALQHIPL 33 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +1 Query: 751 FNWPRFTTSDLGKXWR*PNLIALQHIPL 834 ++WP F GK PNLIALQHIPL Sbjct: 56 WHWPSFYNVVTGKTLALPNLIALQHIPL 83 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/28 (57%), Positives = 17/28 (60%) Frame = -1 Query: 889 LGKGKSLGAFXGYYASWRKGGCAARRLS 806 +GKG G YYASWRKG A RLS Sbjct: 34 VGKGDRCGPLR-YYASWRKGDATASRLS 60 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = -2 Query: 882 RANRWGPFXVITXVGEKGDVLQGD*VXLXPGFSQVRRCKTRPIEL 748 + +R GP KGD PGFSQ RRCKT EL Sbjct: 36 KGDRCGPLRYYAS-WRKGDATASRLSGATPGFSQSRRCKTTASEL 79 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 745 LQFNWPRFTTSDLGKXWR*PNLIALQHIPLFAN 843 + +WP F GK PNL L+HIPL+A+ Sbjct: 4 ITIHWPSFYNVVTGKTLALPNLFDLRHIPLYAS 36 >SB_55415| Best HMM Match : Death (HMM E-Value=1.3e-06) Length = 799 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIKXGXRQXFPKSDVVKRG 759 G+ +G + +RGMCCKAIK G + + V RG Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIKLGTEELYWSFLRVTRG 54 >SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIKXGXR 795 G+ +G + +RGMCCKAIK G R Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIKLGIR 42 >SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +1 Query: 784 GKXWR*PNLIALQHIPLFANXRNNXKRPPTICPFPK 891 GK P+L ALQHIP FA+ R R P PFP+ Sbjct: 18 GKTLAVPSLNALQHIPHFASWR-TYPRSPHRSPFPR 52 >SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 32.3 bits (70), Expect = 0.54 Identities = 22/63 (34%), Positives = 31/63 (49%) Frame = -1 Query: 835 KGGCAARRLSXVXARXFPSQTL*NAAN*IVIRLTIGRIGLRGPPSFXSRFLXQRXSTFSK 656 KGGCAARRLS V S+ A+ +L ++ RG P + +R Q ST Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPGYDTRRQTQILSTLVF 78 Query: 655 LPA 647 +P+ Sbjct: 79 VPS 81 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +3 Query: 669 LXRCXKNLXLNEGGPRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 L R + + +GG +P+ ++ LA + T LNRLAAHPPF Sbjct: 40 LNRLLHGVTIAQGGVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 95 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 31.9 bits (69), Expect = 0.72 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIKXGXRQXFPKSDVVKRGQLNCNTTHYRANWVT 714 G+ +G + +RGMCCKAIK G DV K G+ Y W T Sbjct: 130 GRAIGAGLFAITPAGERGMCCKAIKLGL-------DVPKHGEPAYPVVSYGDGWDT 178 >SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 827 MCCKAIKXGXRQXFPKSDVVKR 762 MC KAIK G FP DVVKR Sbjct: 1 MCSKAIKLGNASVFPSHDVVKR 22 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 31.5 bits (68), Expect = 0.95 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 7/63 (11%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIKXG-------XRQXFPKSDVVKRGQLNCNTTHYRAN 723 G+ +G + +RGMCCKAIK G + P+ + V+ N +T Y+ N Sbjct: 1956 GRAIGAGLFAITPAGERGMCCKAIKLGRCPVQQNIQTLIPECN-VQYSWSNEDTEPYQTN 2014 Query: 722 WVT 714 W + Sbjct: 2015 WTS 2017 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 31.5 bits (68), Expect = 0.95 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = +3 Query: 642 CVAGSLLNVLXRCX--KNLXLNEGGPRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNR 815 C+AG L+++L K L +P+ ++ LA + T LNR Sbjct: 68 CLAGLLVSILFMIIFYKKFGLIATSAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNR 127 Query: 816 LAAHPPF 836 LAAHPPF Sbjct: 128 LAAHPPF 134 >SB_38216| Best HMM Match : APOBEC_C (HMM E-Value=7.3) Length = 340 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIKXG 801 G+ +G + +RGMCCKAIK G Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIKLG 40 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +3 Query: 696 LNEGGPRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 L GG +P+ ++ LA + T LNRLAAHPPF Sbjct: 41 LGRGGIGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 87 >SB_26951| Best HMM Match : CUB (HMM E-Value=0) Length = 794 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIKXG 801 G+ +G + +RGMCCKAIK G Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIKLG 40 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = +3 Query: 735 VSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 +SRIT LA + T LNRLAAHPPF Sbjct: 88 LSRITNSLAVVLQRRDWENTGVTQLNRLAAHPPF 121 >SB_32285| Best HMM Match : Metallophos (HMM E-Value=2.4e-07) Length = 562 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = -1 Query: 736 TIGRIGLRGPPSFXSRFLXQRXSTFSKLPATHIAGNVRQAFNRHTTSKNH 587 T+GR+G P S + +L ST K PA + + FN H T +++ Sbjct: 160 TLGRVGCDSPMSLMTSWLKHMKSTHEKNPADFLL--ITGDFNAHRTDESY 207 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 745 LQFNWPRFTTSDLGKXW-R*PNLIALQHIPLFANXRNN 855 + +WP F GK R P+L LQ+IPL A+ RN+ Sbjct: 4 ITIHWPSFYNVVTGKNTGREPSLFDLQYIPLVASWRNS 41 >SB_12975| Best HMM Match : Zona_pellucida (HMM E-Value=6.6e-12) Length = 515 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +2 Query: 230 YQWFPCPECNCRRYCVQ--LFPSSICNWESHFCLCPCKSSYFMAL 358 Y+ + P CN R YC PSS CNW + + C Y L Sbjct: 102 YEIYGTPTCNLR-YCGNGGAGPSSCCNWNENIRILNCGDFYVYEL 145 >SB_2571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIKXG 801 G+ +G + +RGMCCKAIK G Sbjct: 238 GRAIGAGLFAITPAGERGMCCKAIKLG 264 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 30.7 bits (66), Expect = 1.7 Identities = 24/64 (37%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = -1 Query: 835 KGGCAARRLSXVXARXFPSQTL*NAAN*IVIRLTIGRIGLRGPP--SFXSRFLXQRXSTF 662 KGGCAARRLS V S+ A+ +L ++ RG P S S F R + Sbjct: 93 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPLVSRPSHFSQARANVG 149 Query: 661 SKLP 650 S+LP Sbjct: 150 SRLP 153 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +3 Query: 720 PIRPIVSRITIQLAAFYN 773 PIRPIVS ITI +FYN Sbjct: 41 PIRPIVSHITIHWPSFYN 58 >SB_57792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +3 Query: 783 GKXLAXTXLNRLAAHPPF 836 GK T LNRLAAHPPF Sbjct: 12 GKTPGVTQLNRLAAHPPF 29 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +3 Query: 699 NEGGPRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 N+ R+P+ ++ LA + T LNRLAAHPPF Sbjct: 2 NDRAQRDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 47 >SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -3 Query: 884 KGQIVGGLFXLLRXLAKRGMCCKAIK 807 +G+ V GLF + +RGMCCKAIK Sbjct: 53 EGRSVRGLFAIT-PAGERGMCCKAIK 77 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +3 Query: 801 TXLNRLAAHPPFRQLA**PKKAPNDLPFP 887 T LNRLAAHPPF + P+ PFP Sbjct: 359 TQLNRLAAHPPFASWR--NSERPHRSPFP 385 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 29.9 bits (64), Expect = 2.9 Identities = 25/84 (29%), Positives = 37/84 (44%) Frame = -1 Query: 835 KGGCAARRLSXVXARXFPSQTL*NAAN*IVIRLTIGRIGLRGPPSFXSRFLXQRXSTFSK 656 KGGCAARRLS V S+ A+ +L ++ RG P +R+ + K Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPFPGARYDGVFAMWYGK 100 Query: 655 LPATHIAGNVRQAFNRHTTSKNHG 584 P G+V + N S++ G Sbjct: 101 GPGVDRCGDVFKHGNSAGVSEHGG 124 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 Query: 795 PGFSQVRRCKTRPI 754 PGFSQ RRCK RP+ Sbjct: 35 PGFSQSRRCKRRPV 48 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 Query: 795 PGFSQVRRCKTRPI 754 PGFSQ RRCK RP+ Sbjct: 35 PGFSQSRRCKRRPV 48 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 Query: 795 PGFSQVRRCKTRPI 754 PGFSQ RRCK RP+ Sbjct: 35 PGFSQSRRCKRRPV 48 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIKXGXRQXFPKSDVVKRGQLNCN 744 G+ +G + +RGMCCKAIK + K K + N N Sbjct: 3095 GRAIGAGLFAITPAGERGMCCKAIKLEEEKQKKKKKKKKEEKKNDN 3140 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 29.9 bits (64), Expect = 2.9 Identities = 24/77 (31%), Positives = 31/77 (40%), Gaps = 1/77 (1%) Frame = -1 Query: 835 KGGCAARRLSXVXARXFPSQTL*NAAN*IVIRLTIGRIGLRGPPSFXSRFLXQRXSTFSK 656 KGGCAARRLS V S+ A+ + L + G GP + R + Sbjct: 120 KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPGPKRNLLLLIRVRFLELGR 179 Query: 655 -LPATHIAGNVRQAFNR 608 H G R AFN+ Sbjct: 180 HRENVHKIGTCRSAFNQ 196 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 Query: 795 PGFSQVRRCKTRPI 754 PGFSQ RRCK RP+ Sbjct: 35 PGFSQSRRCKRRPV 48 >SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 Query: 795 PGFSQVRRCKTRPI 754 PGFSQ RRCK RP+ Sbjct: 35 PGFSQSRRCKRRPV 48 >SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 Query: 795 PGFSQVRRCKTRPI 754 PGFSQ RRCK RP+ Sbjct: 35 PGFSQSRRCKRRPV 48 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/51 (39%), Positives = 26/51 (50%) Frame = -1 Query: 835 KGGCAARRLSXVXARXFPSQTL*NAAN*IVIRLTIGRIGLRGPPSFXSRFL 683 KGGCAARRLS V S+ A+ +L ++ RG P+ SR L Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPADDSRLL 91 >SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 854 LLRXLAKRGMCCKAIK 807 LLR LAK G CCKAIK Sbjct: 391 LLRQLAKGGCCCKAIK 406 >SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 Query: 795 PGFSQVRRCKTRPI 754 PGFSQ RRCK RP+ Sbjct: 35 PGFSQSRRCKRRPV 48 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +3 Query: 783 GKXLAXTXLNRLAAHPPF 836 G+ T LNRLAAHPPF Sbjct: 38 GENTGVTQLNRLAAHPPF 55 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +3 Query: 699 NEGGPRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 N P +P+ ++ LA + T LNRLAAHPPF Sbjct: 57 NNQDPGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 102 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/50 (38%), Positives = 25/50 (50%) Frame = -1 Query: 835 KGGCAARRLSXVXARXFPSQTL*NAAN*IVIRLTIGRIGLRGPPSFXSRF 686 KGGCAARRLS V S+ A+ +L ++ RG P+ RF Sbjct: 77 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPNLAVRF 123 >SB_48121| Best HMM Match : Kelch_1 (HMM E-Value=0.023) Length = 1169 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIKXGXR 795 G+ +G + +RGMCCKAIK R Sbjct: 742 GRAIGAGLFAITPAGERGMCCKAIKLDLR 770 >SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +3 Query: 783 GKXLAXTXLNRLAAHPPF 836 G+ T LNRLAAHPPF Sbjct: 63 GENTGVTQLNRLAAHPPF 80 >SB_28739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 270 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -1 Query: 187 TLRENGNRIHQQNCRQTTYPYIPATPLSPT*L-KHSPRSKRHHGTQCRRLH 38 T+ E+ +QNC T + + T L H R++ HHGT+ R H Sbjct: 122 TVHEHSTITIRQNCTITVHEHGTRTTHDKRPLYDHGTRTRHHHGTRTRHEH 172 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +3 Query: 783 GKXLAXTXLNRLAAHPPF 836 G+ T LNRLAAHPPF Sbjct: 704 GENTGVTQLNRLAAHPPF 721 >SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +3 Query: 783 GKXLAXTXLNRLAAHPPF 836 G+ T LNRLAAHPPF Sbjct: 75 GENTGVTQLNRLAAHPPF 92 >SB_55075| Best HMM Match : Keratin_B2 (HMM E-Value=0.46) Length = 202 Score = 26.2 bits (55), Expect(2) = 4.9 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -2 Query: 330 GHKQKCDSQLQMDEGNNCTQYRRQLHSGQGNH 235 GH D Q ++ +CT +Q HS Q H Sbjct: 75 GHCTPIDKQKHSEQPGHCTPMDKQKHSEQPGH 106 Score = 21.4 bits (43), Expect(2) = 4.9 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 Query: 129 HTSQPLHCRPLN 94 H+ QP HC P++ Sbjct: 100 HSEQPGHCTPMD 111 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 702 EGGPRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 E R+P+ ++ LA + T LNRLAAHPPF Sbjct: 53 EAQKRDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 97 >SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 717 NPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 +P+ + ++ LA K T LNRLAAHPPF Sbjct: 2 DPLESTCTHASLSLAVVLQRRDWKNPGITQLNRLAAHPPF 41 >SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIKXGXRQXFP 783 G+ +G + +RGMCCKAIK + P Sbjct: 19 GRAIGAGLFAITPAGERGMCCKAIKLVGKPVVP 51 >SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1090 Score = 29.1 bits (62), Expect = 5.1 Identities = 22/62 (35%), Positives = 30/62 (48%) Frame = -1 Query: 835 KGGCAARRLSXVXARXFPSQTL*NAAN*IVIRLTIGRIGLRGPPSFXSRFLXQRXSTFSK 656 KGGCAARRLS V S+ A+ +L ++ RG P+ FL + S +K Sbjct: 467 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPNLVD-FLALKESPPAK 522 Query: 655 LP 650 P Sbjct: 523 AP 524 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 29.1 bits (62), Expect = 5.1 Identities = 20/59 (33%), Positives = 26/59 (44%) Frame = +3 Query: 660 LNVLXRCXKNLXLNEGGPRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 L + K LN GG +P+ ++ LA + T LNRLAAHPPF Sbjct: 168 LGITYSYIKYSHLNWGG--DPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 224 >SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) Length = 556 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIKXGXRQXFP 783 G+ +G + +RGMCCKAIK + P Sbjct: 268 GRAIGAGLFAITPAGERGMCCKAIKLVGKPVVP 300 >SB_56401| Best HMM Match : Moricin (HMM E-Value=5.8) Length = 106 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIK 38 >SB_54947| Best HMM Match : rve (HMM E-Value=2.3e-31) Length = 1283 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 21 GRAIGAGLFAITPAGERGMCCKAIK 45 >SB_45174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 87 GRAIGAGLFAITPAGERGMCCKAIK 111 >SB_44915| Best HMM Match : VWA (HMM E-Value=0) Length = 541 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIK 38 >SB_43571| Best HMM Match : Ank (HMM E-Value=3e-34) Length = 584 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIK 38 >SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) Length = 980 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIK 38 >SB_41709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 460 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 21 GRAIGAGLFAITPAGERGMCCKAIK 45 >SB_39465| Best HMM Match : PDH (HMM E-Value=1.5) Length = 369 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIK 38 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +3 Query: 735 VSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 +SRITI + + T LNRLAAHPPF Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPF 310 >SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) Length = 73 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -2 Query: 795 PGFSQVRRCKTRP 757 PGFSQ RRCKT P Sbjct: 35 PGFSQSRRCKTTP 47 >SB_27913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 444 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 42 GRAIGAGLFAITPAGERGMCCKAIK 66 >SB_23485| Best HMM Match : PsbJ (HMM E-Value=2.4) Length = 497 Score = 28.7 bits (61), Expect = 6.7 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 296 WMRETTARNTGGSCTQDRETTD 231 W+ T +GGSCTQD T + Sbjct: 136 WLSVTRQEKSGGSCTQDSSTNE 157 >SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2806 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 2659 GRAIGAGLFAITPAGERGMCCKAIK 2683 >SB_16934| Best HMM Match : Ldl_recept_b (HMM E-Value=1.7e-39) Length = 407 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 21 GRAIGAGLFAITPAGERGMCCKAIK 45 >SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3176 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = -1 Query: 127 YIPATPLSPT*LKHSPRSKRHHGTQCRRLHSRSPGDPLVPRA 2 Y P SP + H P S HG Q H PG P + Sbjct: 814 YPPHMKKSPFVVHHPPDSASRHGNQAPEAHHHEPGSYKSPHS 855 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = -1 Query: 883 KGKSLGAFXGYYASWRKGGCAARRLSXV 800 +G+S+ A+ + KGGCAARRLS V Sbjct: 7 EGRSVRAY-SLFRQLAKGGCAARRLSWV 33 >SB_8814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIK 38 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = -1 Query: 835 KGGCAARRLSXVXARXFPSQTL*NAAN*IVIRLTIGRIGLRGPPSF 698 KGGCAARRLS V S+ A+ +L ++ RG P+F Sbjct: 176 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPTF 218 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 28.7 bits (61), Expect = 6.7 Identities = 26/78 (33%), Positives = 32/78 (41%), Gaps = 3/78 (3%) Frame = -1 Query: 835 KGGCAARRLSXVXARXFPSQTL*NAAN*IVIRLTIGRIGLRGPPS---FXSRFLXQRXST 665 KGGCAARRLS V S+ A+ +L ++ RG P S L Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPEVEFITSTALKPTRKK 100 Query: 664 FSKLPATHIAGNVRQAFN 611 K+ ATH V Q N Sbjct: 101 LKKMFATHGVPKVVQTDN 118 >SB_56291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 121 GRAIGAGLFAITPAGERGMCCKAIK 145 >SB_51757| Best HMM Match : Hormone_recep (HMM E-Value=6.4e-37) Length = 405 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 106 GRAIGAGLFAITPAGERGMCCKAIK 130 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = -1 Query: 835 KGGCAARRLSXVXARXFPSQTL*NAAN*IVIRLTIGRIGLRGPPSF 698 KGGCAARRLS V S+ A+ +L ++ RG P+F Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPNF 86 >SB_50538| Best HMM Match : Moricin (HMM E-Value=4.5) Length = 173 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIK 38 >SB_42228| Best HMM Match : Moricin (HMM E-Value=6.6) Length = 126 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 21 GRAIGAGLFAITPAGERGMCCKAIK 45 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.7 bits (61), Expect = 6.7 Identities = 20/61 (32%), Positives = 27/61 (44%) Frame = +3 Query: 654 SLLNVLXRCXKNLXLNEGGPRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPP 833 S LNV + +N G +P+ ++ LA + T LNRLAAHPP Sbjct: 32 SALNVKVKKFNQARVNGG---DPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPP 88 Query: 834 F 836 F Sbjct: 89 F 89 >SB_39908| Best HMM Match : Prismane (HMM E-Value=3) Length = 456 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIK 38 >SB_38217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +3 Query: 786 KXLAXTXLNRLAAHPPF 836 K T LNRLAAHPPF Sbjct: 18 KNTGVTQLNRLAAHPPF 34 >SB_37382| Best HMM Match : Pkinase (HMM E-Value=1e-04) Length = 177 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIK 38 >SB_37193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIK 38 >SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) Length = 1270 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 1133 GRAIGAGLFAITPAGERGMCCKAIK 1157 >SB_30214| Best HMM Match : Exo_endo_phos (HMM E-Value=6.1e-11) Length = 509 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 174 MATGSISKIAARQHIHTSQP 115 M TG I++IA R+ +HT QP Sbjct: 1 MTTGRINQIATRRMVHTGQP 20 >SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = -1 Query: 835 KGGCAARRLSXVXARXFPSQTL*NAAN*IVIRLTIGRIGLRGPPSF 698 KGGCAARRLS V S+ A+ +L ++ RG P+F Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPTF 64 >SB_23924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 21 GRAIGAGLFAITPAGERGMCCKAIK 45 >SB_17450| Best HMM Match : RVT_1 (HMM E-Value=2.2e-25) Length = 472 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIK 38 >SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +3 Query: 783 GKXLAXTXLNRLAAHPPF 836 G+ T LNRLAAHPPF Sbjct: 38 GENPGVTQLNRLAAHPPF 55 >SB_6719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 437 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 193 GRAIGAGLFAITPAGERGMCCKAIK 217 >SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1311 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 122 GRAIGAGLFAITPAGERGMCCKAIK 146 >SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) Length = 108 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 16 GRAIGAGLFAITPAGERGMCCKAIK 40 >SB_213| Best HMM Match : rve (HMM E-Value=2.2e-08) Length = 745 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 881 GQIVGGLFXLLRXLAKRGMCCKAIK 807 G+ +G + +RGMCCKAIK Sbjct: 398 GRAIGAGLFAITPAGERGMCCKAIK 422 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 42 PGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 254 PGFSQSRRCKTTASEL 269 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/46 (39%), Positives = 23/46 (50%) Frame = -1 Query: 835 KGGCAARRLSXVXARXFPSQTL*NAAN*IVIRLTIGRIGLRGPPSF 698 KGGCAARRLS V S+ A+ +L ++ RG P F Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPGF 64 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 922 PGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 35 PGFSQSRRCKTTASEL 50 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 34 PGFSQSRRCKTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 409 PGFSQSRRCKTTASEL 424 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 28.3 bits (60), Expect = 8.9 Identities = 21/66 (31%), Positives = 29/66 (43%) Frame = +3 Query: 639 MCVAGSLLNVLXRCXKNLXLNEGGPRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRL 818 MC A LL + R ++ G +P+ ++ LA + T LNRL Sbjct: 62 MCRASDLLWSVERLIDLAAISIRGG-DPLESTCRHASLALAVVLQRRDWENPGVTQLNRL 120 Query: 819 AAHPPF 836 AAHPPF Sbjct: 121 AAHPPF 126 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 258 PGFSQSRRCKTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 325 PGFSQSRRCKTTASEL 340 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 714 RNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 R+P+ ++ LA + T LNRLAAHPPF Sbjct: 94 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 134 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 711 PRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 P +P+ ++ LA + T LNRLAAHPPF Sbjct: 1 PGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 42 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/50 (34%), Positives = 22/50 (44%) Frame = +3 Query: 687 NLXLNEGGPRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 NL N +P+ ++ LA + T LNRLAAHPPF Sbjct: 68 NLNPNPNPNGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 117 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 8.9 Identities = 19/50 (38%), Positives = 24/50 (48%) Frame = -1 Query: 835 KGGCAARRLSXVXARXFPSQTL*NAAN*IVIRLTIGRIGLRGPPSFXSRF 686 KGGCAARRLS V S+ A+ +L ++ RG P S F Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPPVVSTF 68 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 391 PGFSQSRRCKTTASEL 406 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 83 PGFSQSRRCKTTASEL 98 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 711 PRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 P +P+ ++ LA + T LNRLAAHPPF Sbjct: 101 PGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 142 >SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) Length = 135 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 711 PRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 P +P+ ++ LA + T LNRLAAHPPF Sbjct: 90 PGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 131 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 711 PRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 P +P+ ++ LA + T LNRLAAHPPF Sbjct: 64 PGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 105 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 42 PGFSQSRRCKTTASEL 57 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +3 Query: 708 GPRN--PIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 GPR+ P+ ++ LA + T LNRLAAHPPF Sbjct: 2 GPRDGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 46 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 35 PGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 35 PGFSQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 42 PGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 42 PGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 65 PGFSQSRRCKTTASEL 80 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 711 PRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 P +P+ ++ LA + T LNRLAAHPPF Sbjct: 29 PGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 70 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 301 PGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 285 PGFSQSRRCKTTASEL 300 >SB_10756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 713 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 183 KVYGSLPLRSRH*YFGISGFPVLSATAAGIACSCFPH 293 +V+G + R+ + +SGF L A IA FPH Sbjct: 279 RVFGCAKILCRYSFVTLSGFRTLGARRVRIATPSFPH 315 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 711 PRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 P +P+ ++ LA + T LNRLAAHPPF Sbjct: 19 PGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 60 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 35 PGFSQSRRCKTTASEL 50 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 711 PRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 P +P+ ++ LA + T LNRLAAHPPF Sbjct: 43 PGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 84 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 711 PRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 P +P+ ++ LA + T LNRLAAHPPF Sbjct: 78 PGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 119 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 274 PGFSQSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 299 PGFSQSRRCKTTASEL 314 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 711 PRNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 P +P+ ++ LA + T LNRLAAHPPF Sbjct: 66 PGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 107 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 483 PGFSQSRRCKTTASEL 498 >SB_52095| Best HMM Match : tRNA-synt_2c (HMM E-Value=0) Length = 756 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = +3 Query: 312 HTSAYARANRHISWH*SDLVYCKSISNSLGDIYHGSVDPRRDGCAFKRAVN 464 H + ++ I L++ + N I+ G+VDP D KRAVN Sbjct: 58 HNHTFVPSSSVIPHEDPTLLFANAGMNQYKSIFLGTVDPNSDMSKLKRAVN 108 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 152 PGFSQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 318 PGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 168 PGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 42 PGFSQSRRCKTTASEL 57 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 361 PGFSQSRRCKTTASEL 376 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 42 PGFSQSRRCKTTASEL 57 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 28 PGFSQSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 227 PGFSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 619 PGFSQSRRCKTTASEL 634 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 255 PGFSQSRRCKTTASEL 270 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 533 PGFSQSRRCKTTASEL 548 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 116 PGFSQSRRCKTTASEL 131 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 714 RNPIRPIVSRITIQLAAFYNV*LGKXLAXTXLNRLAAHPPF 836 R+P+ ++ LA + T LNRLAAHPPF Sbjct: 10 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 50 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 424 PGFSQSRRCKTTASEL 439 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 28 PGFSQSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 795 PGFSQVRRCKTRPIEL 748 PGFSQ RRCKT EL Sbjct: 217 PGFSQSRRCKTTASEL 232 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,252,469 Number of Sequences: 59808 Number of extensions: 741400 Number of successful extensions: 7901 Number of sequences better than 10.0: 190 Number of HSP's better than 10.0 without gapping: 4836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7801 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2562198215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -