BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0057.Seq (583 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 26 0.31 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 0.95 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 0.95 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 2.2 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 22 3.8 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 3.8 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 3.8 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 5.1 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 6.7 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 25.8 bits (54), Expect = 0.31 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 71 FMNL*TTRFPTAGHLSQCTPMILVAPFSLCRERGETRWL 187 +++ T F T+ + C ++V PFS E E RWL Sbjct: 75 YLHTATNYFVTSLAFADCLVGLVVMPFSAIYEVLENRWL 113 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.2 bits (50), Expect = 0.95 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 Query: 236 GHAVGDIPGVRFKVVKVANVSLL 168 GH V D+PGVR +V++ + LL Sbjct: 69 GHPVNDVPGVR-RVLRNGTLVLL 90 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.2 bits (50), Expect = 0.95 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 Query: 236 GHAVGDIPGVRFKVVKVANVSLL 168 GH V D+PGVR +V++ + LL Sbjct: 69 GHPVNDVPGVR-RVLRNGTLVLL 90 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.0 bits (47), Expect = 2.2 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -3 Query: 236 GHAVGDIPGVR 204 G AVGD+PG+R Sbjct: 42 GSAVGDVPGLR 52 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 435 PKGLAFHFVPMWAFLNSLSA 494 PK +A H++ W FL+ +S+ Sbjct: 157 PKLIAKHYLRTWFFLDLISS 176 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 435 PKGLAFHFVPMWAFLNSLSA 494 PK +A H++ W FL+ +S+ Sbjct: 157 PKLIAKHYLRTWFFLDLISS 176 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 435 PKGLAFHFVPMWAFLNSLSA 494 PK +A H++ W FL+ +S+ Sbjct: 157 PKLIAKHYLRTWFFLDLISS 176 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 5.1 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -1 Query: 376 PNSAIRKCV 350 PNSA+RKC+ Sbjct: 584 PNSAVRKCM 592 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 427 SHAKGIVLEKVGVEAKQPNSAIR 359 +H K +VLE+ ++K P S R Sbjct: 73 THEKKLVLERSKTKSKSPESRDR 95 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,516 Number of Sequences: 438 Number of extensions: 3779 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16870914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -