BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0056.Seq (875 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 23 4.2 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 7.3 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 9.6 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 9.6 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 9.6 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 22.6 bits (46), Expect = 4.2 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +1 Query: 415 PIPPIDSVAQIGSPENSSSYSGVRRKRTIRSS*PGGQPFPALLVR 549 P P SV ++G P+ ++ + R + ++S P G P +R Sbjct: 66 PQPLHPSVPRLGHPQWPFAWGSLXRSSSPQTSAPTGPPIVRCALR 110 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.8 bits (44), Expect = 7.3 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = -3 Query: 420 YGPRRSYPGYQKQLPFPEHPVHHGSVS 340 YG +PG Q P VHH S Sbjct: 114 YGSDLYFPGATSQPPTDNSHVHHHQTS 140 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 444 DRVAREQFIVFRSTQEANHTQFMTRWSTI 530 +RV RE +FR+ NH ++ S I Sbjct: 298 ERVMRELGRIFRAYCRENHASWVNHLSNI 326 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.4 bits (43), Expect = 9.6 Identities = 5/13 (38%), Positives = 9/13 (69%) Frame = -3 Query: 456 WRPDLGNRIYRWY 418 WR D+G ++ W+ Sbjct: 197 WREDIGLNLHHWH 209 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -2 Query: 829 GKTGVKPXXKTNXSC 785 GKTG K KTN C Sbjct: 308 GKTGRKTVLKTNKYC 322 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,714 Number of Sequences: 336 Number of extensions: 4731 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24203322 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -