BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0056.Seq (875 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061833-1|AAL27644.1| 998|Drosophila melanogaster SD07678p pro... 30 4.8 AE014298-400|AAF45784.2| 998|Drosophila melanogaster CG32796-PB... 30 4.8 >AY061833-1|AAL27644.1| 998|Drosophila melanogaster SD07678p protein. Length = 998 Score = 29.9 bits (64), Expect = 4.8 Identities = 24/76 (31%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Frame = -1 Query: 515 GHELRMVRFLRTPEYDELFSGDPIWAT-ESIGGMGLDGRTLVTKNSFRFLNTLYTMGPSP 339 G+ LR+ T E DE P+W ES GMG + +KN +M P Sbjct: 413 GNILRVNPLEITGEDDEPLGEVPVWPVHESNTGMGTSSTSGGSKNKSGRRKFKASMVPPS 472 Query: 338 EPNMTILWSEKLPLNF 291 PN+T L E + L + Sbjct: 473 RPNVTRLSDESVMLRW 488 >AE014298-400|AAF45784.2| 998|Drosophila melanogaster CG32796-PB, isoform B protein. Length = 998 Score = 29.9 bits (64), Expect = 4.8 Identities = 24/76 (31%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Frame = -1 Query: 515 GHELRMVRFLRTPEYDELFSGDPIWAT-ESIGGMGLDGRTLVTKNSFRFLNTLYTMGPSP 339 G+ LR+ T E DE P+W ES GMG + +KN +M P Sbjct: 413 GNILRVNPLEITGEDDEPLGEVPVWPVHESNTGMGTSSTSGGSKNKSGRRKFKASMVPPS 472 Query: 338 EPNMTILWSEKLPLNF 291 PN+T L E + L + Sbjct: 473 RPNVTRLSDESVMLRW 488 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 40,739,058 Number of Sequences: 53049 Number of extensions: 943511 Number of successful extensions: 2758 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2755 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4250176164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -