BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0051.Seq (642 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY748838-1|AAV28186.1| 155|Anopheles gambiae cytochrome P450 pr... 49 1e-07 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 38 4e-04 AY745206-1|AAU93473.1| 91|Anopheles gambiae cytochrome P450 pr... 37 5e-04 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 37 6e-04 AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 36 8e-04 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 36 8e-04 AY745225-1|AAU93492.1| 156|Anopheles gambiae cytochrome P450 pr... 36 0.001 AY748841-1|AAV28189.1| 158|Anopheles gambiae cytochrome P450 pr... 35 0.002 AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 35 0.002 AY748840-1|AAV28188.1| 104|Anopheles gambiae cytochrome P450 pr... 35 0.003 AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 pr... 35 0.003 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 33 0.010 AY748830-1|AAV28178.1| 95|Anopheles gambiae cytochrome P450 pr... 32 0.013 AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CY... 32 0.013 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 32 0.018 AY745208-1|AAU93475.1| 103|Anopheles gambiae cytochrome P450 pr... 31 0.023 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 31 0.023 AY745226-1|AAU93493.1| 86|Anopheles gambiae cytochrome P450 pr... 31 0.031 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 31 0.031 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 31 0.031 AY745224-1|AAU93491.1| 103|Anopheles gambiae cytochrome P450 pr... 31 0.041 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 31 0.041 AY748845-1|AAV28191.1| 102|Anopheles gambiae cytochrome P450 pr... 29 0.095 AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 pr... 29 0.13 AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CY... 29 0.13 AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 pr... 29 0.17 AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CY... 29 0.17 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 28 0.22 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 28 0.22 AY062204-1|AAL58565.1| 150|Anopheles gambiae cytochrome P450 CY... 28 0.22 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 28 0.29 AY745205-1|AAU93472.1| 91|Anopheles gambiae cytochrome P450 pr... 27 0.38 AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CY... 27 0.38 AY748849-1|AAV28195.1| 106|Anopheles gambiae cytochrome P450 pr... 27 0.50 AY745219-1|AAU93486.1| 104|Anopheles gambiae cytochrome P450 pr... 27 0.50 AY745227-1|AAU93494.1| 99|Anopheles gambiae cytochrome P450 pr... 27 0.67 AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 27 0.67 AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 27 0.67 AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase... 27 0.67 AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 pr... 26 0.88 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 26 0.88 AY062195-1|AAL58556.1| 139|Anopheles gambiae cytochrome P450 CY... 26 0.88 AY062192-1|AAL58553.1| 151|Anopheles gambiae cytochrome P450 CY... 26 0.88 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 26 0.88 AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CY... 25 2.0 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 25 2.7 AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CY... 25 2.7 AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CY... 25 2.7 AY062190-1|AAL58551.1| 151|Anopheles gambiae cytochrome P450 CY... 25 2.7 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 24 3.6 AY062198-1|AAL58559.1| 153|Anopheles gambiae cytochrome P450 CY... 24 3.6 AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 24 3.6 AY748844-1|AAV28190.1| 107|Anopheles gambiae cytochrome P450 pr... 24 4.7 AY062191-1|AAL58552.1| 151|Anopheles gambiae cytochrome P450 CY... 24 4.7 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 24 4.7 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 24 4.7 AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase p... 24 4.7 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 23 6.2 AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CY... 23 6.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 6.2 U50474-1|AAA93476.1| 62|Anopheles gambiae protein ( Anopheles ... 23 8.2 AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. 23 8.2 AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. 23 8.2 AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. 23 8.2 AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. 23 8.2 AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. 23 8.2 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 23 8.2 >AY748838-1|AAV28186.1| 155|Anopheles gambiae cytochrome P450 protein. Length = 155 Score = 48.8 bits (111), Expect = 1e-07 Identities = 19/43 (44%), Positives = 28/43 (65%) Frame = -3 Query: 430 DTMVVSNYTNILLDENYFPEPYSFKPERFLVNGRVSLPDHYFP 302 DTM+V + ++LDEN + P F PERFL +G++ +P Y P Sbjct: 71 DTMLVGMFRGMMLDENLWENPTQFNPERFLKDGKIHIPAQYHP 113 Score = 34.3 bits (75), Expect = 0.003 Identities = 13/24 (54%), Positives = 20/24 (83%) Frame = -1 Query: 507 VQRKAQEEIDRVVGKDRVPSVNDR 436 V R+ QEEID V+G++R+P++ DR Sbjct: 6 VMRRIQEEIDDVIGRNRLPTLEDR 29 Score = 29.5 bits (63), Expect = 0.095 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 302 FGLAKHRCMGDALAK 258 FG+ KHRCMG+ +AK Sbjct: 114 FGVGKHRCMGELMAK 128 Score = 27.9 bits (59), Expect = 0.29 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 276 GRCISQVHIFVFTTTMLQRFSLVPVPGEGLPS 181 G +++ ++F+F TT LQ F L+ G +PS Sbjct: 123 GELMAKSNLFLFLTTTLQSFDLLLPDGAPIPS 154 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 37.5 bits (83), Expect = 4e-04 Identities = 17/50 (34%), Positives = 30/50 (60%) Frame = -2 Query: 605 QLVAMCMDMFMAGTETTSKSMSFCFSYLVREQESKGKLRRKLTGL*EKIG 456 +L A F+AG+ET+S +M+FC L + + +G+LR ++ E+ G Sbjct: 300 ELAAQVFVSFLAGSETSSTTMNFCLYELAKNPDIQGRLREEIERAVEENG 349 Score = 27.1 bits (57), Expect = 0.50 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 391 DENYFPEPYSFKPERFL 341 D ++PEP F P+RFL Sbjct: 413 DPEFYPEPDQFNPDRFL 429 >AY745206-1|AAU93473.1| 91|Anopheles gambiae cytochrome P450 protein. Length = 91 Score = 37.1 bits (82), Expect = 5e-04 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFLVNGRVSLPDHYFP 302 T V+ I +DE YFPEP + P+RF PD Y+P Sbjct: 7 TQVIIPLLGISMDEKYFPEPEVYMPQRFDEQAPNYDPDAYYP 48 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 36.7 bits (81), Expect = 6e-04 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = -3 Query: 391 DENYFPEPYSFKPERFLVNGRVSLPDHYFP 302 D +YFP+PY FKPERF V Y P Sbjct: 405 DPDYFPDPYDFKPERFAVKNDFKNNFSYLP 434 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 36.3 bits (80), Expect = 8e-04 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = -2 Query: 602 LVAMCMDMFMAGTETTSKSMSFCFSYLVREQESKGKLRRKLT 477 + A F+AG ET+S +MSFC L QE + K R+ +T Sbjct: 296 VAAQAFVFFLAGFETSSTAMSFCLYELALNQELQDKARQNIT 337 Score = 24.2 bits (50), Expect = 3.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 391 DENYFPEPYSFKPERF 344 D +FP P F P+RF Sbjct: 407 DPEHFPNPEQFDPDRF 422 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 36.3 bits (80), Expect = 8e-04 Identities = 20/59 (33%), Positives = 33/59 (55%) Frame = -2 Query: 632 GEVNTYSEGQLVAMCMDMFMAGTETTSKSMSFCFSYLVREQESKGKLRRKLTGL*EKIG 456 GEV + +L A F+AG ET+S +M+FC L + + + +LRR++ E+ G Sbjct: 293 GEVGM-TMNELAAQVFIFFLAGFETSSTTMNFCLYELAKHPDIQERLRREIERAVEENG 350 Score = 26.6 bits (56), Expect = 0.67 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 391 DENYFPEPYSFKPERF 344 D Y+P+P F PERF Sbjct: 414 DAQYYPDPERFDPERF 429 >AY745225-1|AAU93492.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 35.5 bits (78), Expect = 0.001 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFLVNGRVSLPDHYF 305 T V+ I D + +P PY F P+RFL R S P H F Sbjct: 107 TSVIIPVYAIHYDPDIYPMPYKFDPDRFLEENRKSRPRHAF 147 >AY748841-1|AAV28189.1| 158|Anopheles gambiae cytochrome P450 protein. Length = 158 Score = 35.1 bits (77), Expect = 0.002 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -3 Query: 430 DTMVVSNYTNILLDENYFPEPYSFKPERFLVNGRVSLPD 314 DT++ N ++ + + EP F+PERFL GR+ PD Sbjct: 119 DTLIFLNNYDLSMSPALWDEPERFRPERFLQQGRLVKPD 157 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 35.1 bits (77), Expect = 0.002 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = -2 Query: 632 GEVNTYSEGQLVAMCMDMFMAGTETTSKSMSFCFSYLVREQESKGKLRRKL 480 GEV ++ +L A F+AG ET+S + SFC L + + + +LR ++ Sbjct: 295 GEVGM-TQNELAAQAFVFFLAGFETSSTTQSFCLYELAKNPDIQERLREEI 344 Score = 25.8 bits (54), Expect = 1.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 391 DENYFPEPYSFKPERFL 341 D +++P+P F P+RFL Sbjct: 416 DPDHYPDPERFNPDRFL 432 >AY748840-1|AAV28188.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 34.7 bits (76), Expect = 0.003 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T++++ I E+ FPEP++F+PERFL Sbjct: 46 TLIINGLDYINHQEDVFPEPHTFRPERFL 74 >AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 protein. Length = 105 Score = 34.7 bits (76), Expect = 0.003 Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFLVNGRVSL-PDHYFP 302 T+V I D YFPEP F PERF R ++ P Y P Sbjct: 48 TLVFIPVVGIHFDPKYFPEPERFDPERFSAANRNNIQPGTYLP 90 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 32.7 bits (71), Expect = 0.010 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFLVNGRVSLPDHYFP 302 T V+ +I ++E YFP+P + PERF + D Y+P Sbjct: 389 TQVIIPLLSISMNEKYFPDPELYSPERFDEATKNYDADAYYP 430 >AY748830-1|AAV28178.1| 95|Anopheles gambiae cytochrome P450 protein. Length = 95 Score = 32.3 bits (70), Expect = 0.013 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -3 Query: 391 DENYFPEPYSFKPERFLVNGRVSL-PDHYFP 302 D Y+P P F PERF V R + P+ Y P Sbjct: 54 DPQYYPNPSKFDPERFSVENRDKINPNTYLP 84 >AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CYP6Z1 protein. Length = 494 Score = 32.3 bits (70), Expect = 0.013 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFLVNGRVSLPDHYFP 302 T ++ I ++E YFPEP + PERF + D Y+P Sbjct: 389 TQMIIPLLGISMNEKYFPEPELYSPERFDEATKNYDADAYYP 430 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 31.9 bits (69), Expect = 0.018 Identities = 16/58 (27%), Positives = 32/58 (55%) Frame = -2 Query: 614 SEGQLVAMCMDMFMAGTETTSKSMSFCFSYLVREQESKGKLRRKLTGL*EKIGYRA*T 441 SE +++A C+ F+AG +T + SM+F + E + +L ++ + E + +A T Sbjct: 319 SENEMIAQCLLFFLAGFDTIATSMTFVLYEVTLAPEIQQRLYEEIQQVSETLDGKALT 376 Score = 25.4 bits (53), Expect = 1.5 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -3 Query: 391 DENYFPEPYSFKPERFLVNGRVSLP 317 D ++P+P F PERF + +P Sbjct: 437 DPRFYPDPDRFDPERFNDENKHKIP 461 >AY745208-1|AAU93475.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 31.5 bits (68), Expect = 0.023 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -3 Query: 430 DTMVVSNYTNILLDENYFPEPYSFKPERFLVNGR 329 DT V+ + +D +Y+ +P F+PERFL + R Sbjct: 35 DTTVLIGLRTVHMDRDYWGDPEVFRPERFLESER 68 Score = 27.1 bits (57), Expect = 0.50 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -2 Query: 311 LLSFGLAKHRCMGDALAK 258 L+ FG+ K RC+G+ LA+ Sbjct: 81 LMFFGIGKRRCLGEVLAR 98 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 31.5 bits (68), Expect = 0.023 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -2 Query: 599 VAMCMDMFMAGTETTSKSMSFCFSYLVREQESKGKLRRKL 480 V M +DM +AG +TTS + L + E + KLR +L Sbjct: 316 VIMSLDMLIAGIDTTSSGSTGVLYCLAKNPEKQAKLREEL 355 >AY745226-1|AAU93493.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 31.1 bits (67), Expect = 0.031 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -3 Query: 400 ILLDENYFPEPYSFKPERF 344 I +D Y+PEP+ F PERF Sbjct: 42 IHMDPKYYPEPHQFDPERF 60 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 31.1 bits (67), Expect = 0.031 Identities = 17/39 (43%), Positives = 22/39 (56%) Frame = -2 Query: 599 VAMCMDMFMAGTETTSKSMSFCFSYLVREQESKGKLRRK 483 V M DM MAG +TTS S +F Y + + SK + RK Sbjct: 315 VVMAFDMIMAGIDTTSSS-TFGILYCLAKNPSKQAILRK 352 Score = 30.3 bits (65), Expect = 0.054 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFLVNGR 329 T VV + D YFP+P +F PER+L +G+ Sbjct: 412 TEVVMGTLALQRDAAYFPQPDAFLPERWLPDGQ 444 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 31.1 bits (67), Expect = 0.031 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 430 DTMVVSNYTNILLDENYFPEPYSFKPERFLVNGRVSLP 317 DT + +L DE YF P F PER+L + S+P Sbjct: 405 DTDIAMGAQVLLRDEKYFHRPTEFIPERWLNDRDASIP 442 Score = 29.9 bits (64), Expect = 0.072 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -2 Query: 599 VAMCMDMFMAGTETTSKSMSFCFSYLVREQESKGKLRRKL 480 V M +DM AG +TTS L + E + KLR +L Sbjct: 309 VIMALDMIFAGIDTTSAGSVAILYCLAKNPEKQAKLRAEL 348 >AY745224-1|AAU93491.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 30.7 bits (66), Expect = 0.041 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERF 344 T VV Y +I D +F +PY + P+RF Sbjct: 13 TTVVLPYYSICFDAEHFADPYKYDPKRF 40 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 30.7 bits (66), Expect = 0.041 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFLVNGRVSLPDHYFP 302 T V+ +I ++E YFP+P PERF + D Y+P Sbjct: 389 TQVIIPLWSISMNEKYFPDPELHSPERFDEATKNYDADAYYP 430 >AY748845-1|AAV28191.1| 102|Anopheles gambiae cytochrome P450 protein. Length = 102 Score = 29.5 bits (63), Expect = 0.095 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -3 Query: 382 YFPEPYSFKPERFLVNGRVSLPDHYFP 302 YFPEP F+PERF P Y P Sbjct: 22 YFPEPDQFRPERFADGETKRNPFAYIP 48 >AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 29.1 bits (62), Expect = 0.13 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -3 Query: 430 DTMVVSNYTNILLDENYFPEPYSFKPERFL-VNGRVSL 320 DT+V+ I Y+ +P F+PERFL +GR++L Sbjct: 90 DTLVLIGLDAIHNQREYWGDPERFRPERFLDEHGRLAL 127 Score = 28.7 bits (61), Expect = 0.17 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -1 Query: 507 VQRKAQEEIDRVVGKDRVPSVNDR 436 V + Q EID VVG R+P+++DR Sbjct: 25 VIERMQREIDEVVGHGRLPTLDDR 48 >AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CYP4D17 protein. Length = 151 Score = 29.1 bits (62), Expect = 0.13 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = -3 Query: 391 DENYFPEPYSFKPERFLV--NGRVSLPDHYFP 302 + YFPEP F PERF V + + P Y P Sbjct: 109 EARYFPEPEKFDPERFNVERSAEKTNPYQYIP 140 >AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 protein. Length = 101 Score = 28.7 bits (61), Expect = 0.17 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 388 ENYFPEPYSFKPERFLVNGRV 326 + YFPEP F PER+L G + Sbjct: 10 QQYFPEPDRFVPERWLKRGEL 30 >AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CYP4C27 protein. Length = 150 Score = 28.7 bits (61), Expect = 0.17 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V + ++ DE ++P+P F P+RFL Sbjct: 97 TIVGIHAYHVHRDERFYPDPEKFDPDRFL 125 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 28.3 bits (60), Expect = 0.22 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERF 344 TM+ +I D + FPEP F PERF Sbjct: 393 TMLFIPIFSIQRDASLFPEPEKFDPERF 420 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 28.3 bits (60), Expect = 0.22 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 391 DENYFPEPYSFKPERF 344 D FP+P +FKPERF Sbjct: 404 DPTLFPDPLAFKPERF 419 >AY062204-1|AAL58565.1| 150|Anopheles gambiae cytochrome P450 CYP4C28 protein. Length = 150 Score = 28.3 bits (60), Expect = 0.22 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -3 Query: 391 DENYFPEPYSFKPERFL-VNGRVSLPDHYFP 302 D YFP P F P+RFL N P Y P Sbjct: 109 DPQYFPNPEKFYPDRFLPENSTNRHPYSYIP 139 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 27.9 bits (59), Expect = 0.29 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 593 MCMDMFMAGTETTSKSMSFCFSYLVREQESKGKLRRKL 480 M MD AG +TTS + L + E + KLR +L Sbjct: 316 MSMDSLFAGVDTTSSGSTGILYCLAKNPEKQEKLRAEL 353 Score = 24.6 bits (51), Expect = 2.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 391 DENYFPEPYSFKPERFL 341 +E YF P F PER+L Sbjct: 423 EEGYFTRPSEFMPERWL 439 >AY745205-1|AAU93472.1| 91|Anopheles gambiae cytochrome P450 protein. Length = 91 Score = 27.5 bits (58), Expect = 0.38 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 430 DTMVVSNYTNILLDENYFPEPYSFKPERFL 341 DT+V I D +++P+P F P+RFL Sbjct: 26 DTVVQIPIYAIQRDPDHYPDPERFDPDRFL 55 >AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CYP6M4 protein. Length = 424 Score = 27.5 bits (58), Expect = 0.38 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERF 344 T V+ I D +FPEP F PERF Sbjct: 334 TSVMIPVLGIHHDPEHFPEPERFDPERF 361 >AY748849-1|AAV28195.1| 106|Anopheles gambiae cytochrome P450 protein. Length = 106 Score = 27.1 bits (57), Expect = 0.50 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T V+ N + D Y+P+ F+PERFL Sbjct: 36 TEVMLNIYVMQNDPQYYPDADQFRPERFL 64 >AY745219-1|AAU93486.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 27.1 bits (57), Expect = 0.50 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 385 NYFPEPYSFKPERFL 341 +Y+PEP F PERF+ Sbjct: 71 DYYPEPERFSPERFV 85 >AY745227-1|AAU93494.1| 99|Anopheles gambiae cytochrome P450 protein. Length = 99 Score = 26.6 bits (56), Expect = 0.67 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 391 DENYFPEPYSFKPERF 344 D YFP P F PERF Sbjct: 54 DPKYFPNPTVFDPERF 69 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 26.6 bits (56), Expect = 0.67 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -3 Query: 391 DENYFPEPYSFKPERFLVNG-RVSLPDHYFP 302 D ++PEP F P+RF G R P + P Sbjct: 401 DPQHYPEPERFDPDRFTPEGCRQRAPYTFLP 431 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 26.6 bits (56), Expect = 0.67 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 391 DENYFPEPYSFKPERF 344 D +FPEP ++PERF Sbjct: 409 DPAHFPEPEQYRPERF 424 >AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase subunit 2 protein. Length = 686 Score = 26.6 bits (56), Expect = 0.67 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 349 RFLVNGRVSLPDHYFPSVLRSI 284 R L N R LP+ YFP ++RS+ Sbjct: 257 RPLTNLREPLPEGYFPKIIRSL 278 >AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 protein. Length = 276 Score = 26.2 bits (55), Expect = 0.88 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = -2 Query: 314 PLLSFGLAKHRCMGDALAKCISSFSLLQCCRGSRWCL 204 P + FGL C+GD + L+ R R+ L Sbjct: 220 PFMPFGLGPRHCIGDTFGLMLVKVGLVAMVRSFRFTL 256 Score = 25.8 bits (54), Expect = 1.2 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -3 Query: 391 DENYFPEPYSFKPERFLVNGRVS 323 D Y+P+P + P+RF + ++S Sbjct: 190 DPAYYPQPDVYNPDRFAASSKLS 212 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 26.2 bits (55), Expect = 0.88 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -3 Query: 430 DTMVVSNYTNILLDENYFPEPYSFKPERFLVNGRVSLPDHYF 305 DTM++ I D + +P+P F P+RF + + H F Sbjct: 399 DTMLMIPIYAIHHDASIYPDPERFDPDRFALAATHARHTHAF 440 >AY062195-1|AAL58556.1| 139|Anopheles gambiae cytochrome P450 CYP4H18 protein. Length = 139 Score = 26.2 bits (55), Expect = 0.88 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 403 NILLDENYFPEPYSFKPERF 344 NI + FPEP F PERF Sbjct: 106 NIHRNRTVFPEPERFDPERF 125 Score = 24.2 bits (50), Expect = 3.6 Identities = 11/24 (45%), Positives = 18/24 (75%), Gaps = 2/24 (8%) Frame = -1 Query: 507 VQRKAQEEIDRVVGKDR--VPSVN 442 VQ++ EEIDR++G+++ VP N Sbjct: 30 VQQRLYEEIDRMLGEEKTNVPLTN 53 >AY062192-1|AAL58553.1| 151|Anopheles gambiae cytochrome P450 CYP4H17 protein. Length = 151 Score = 26.2 bits (55), Expect = 0.88 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -3 Query: 412 NYTNILLDENYFPEPYSFKPERF 344 N N+ + FPEP F PERF Sbjct: 103 NIFNVHRNPKVFPEPEKFIPERF 125 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 26.2 bits (55), Expect = 0.88 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 Query: 400 ILLDENYFPEPYSFKPERF 344 I+ D FPEP F PERF Sbjct: 433 IMRDPQLFPEPDRFWPERF 451 >AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 124 TVVIGTY-KIHRREDLYPHPETFNPDNFL 151 >AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 124 TVVIGTY-KIHRREDLYPHPETFNPDNFL 151 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 124 TVVIGTY-KIHRREDLYPHPETFNPDNFL 151 >AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 124 TVVIGTY-KIHRREDLYPHPETFNPDNFL 151 >AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 127 TVVIGTY-KIHRREDLYPHPETFNPDNFL 154 >AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 127 TVVIGTY-KIHRREDLYPHPETFNPDNFL 154 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 136 TVVIGTY-KIHRREDLYPHPETFNPDNFL 163 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 136 TVVIGTY-KIHRREDLYPHPETFNPDNFL 163 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 138 TVVIGTY-KIHRREDLYPHPETFNPDNFL 165 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 138 TVVIGTY-KIHRREDLYPHPETFNPDNFL 165 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 124 TVVIGTY-KIHRREDLYPHPETFNPDNFL 151 >AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 124 TVVIGTY-KIHRREDLYPHPETFNPDNFL 151 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 138 TVVIGTY-KIHRREDLYPHPETFNPDNFL 165 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 138 TVVIGTY-KIHRREDLYPHPETFNPDNFL 165 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 136 TVVIGTY-KIHRREDLYPHPETFNPDNFL 163 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 136 TVVIGTY-KIHRREDLYPHPETFNPDNFL 163 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 138 TVVIGTY-KIHRREDLYPHPETFNPDNFL 165 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 138 TVVIGTY-KIHRREDLYPHPETFNPDNFL 165 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 136 TVVIGTY-KIHRREDLYPHPETFNPDNFL 163 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 136 TVVIGTY-KIHRREDLYPHPETFNPDNFL 163 >AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 123 TVVIGTY-KIHRREDLYPHPETFNPDNFL 150 >AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 123 TVVIGTY-KIHRREDLYPHPETFNPDNFL 150 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 136 TVVIGTY-KIHRREDLYPHPETFNPDNFL 163 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 136 TVVIGTY-KIHRREDLYPHPETFNPDNFL 163 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 136 TVVIGTY-KIHRREDLYPHPETFNPDNFL 163 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 136 TVVIGTY-KIHRREDLYPHPETFNPDNFL 163 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 137 TVVIGTY-KIHRREDLYPHPETFNPDNFL 164 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 137 TVVIGTY-KIHRREDLYPHPETFNPDNFL 164 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 135 TVVIGTY-KIHRREDLYPHPETFNPDNFL 162 >AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CYP4G17 protein. Length = 151 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 427 TMVVSNYTNILLDENYFPEPYSFKPERFL 341 T+V+ Y I E+ +P P +F P+ FL Sbjct: 99 TVVIGTY-KIHRREDLYPHPETFNPDNFL 126 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 24.6 bits (51), Expect = 2.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 391 DENYFPEPYSFKPERF 344 D +FP+P F P+RF Sbjct: 346 DPEHFPDPERFDPDRF 361 >AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CYP4D22 protein. Length = 151 Score = 24.6 bits (51), Expect = 2.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 391 DENYFPEPYSFKPERF 344 D FP+P F PERF Sbjct: 109 DPTLFPDPERFDPERF 124 >AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CYP4D16 protein. Length = 151 Score = 24.6 bits (51), Expect = 2.7 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -3 Query: 382 YFPEPYSFKPERFLV--NGRVSLPDHYFP 302 +FP P F PERF V + + P Y P Sbjct: 112 FFPNPEKFDPERFNVETSAEKTNPYQYVP 140 >AY062190-1|AAL58551.1| 151|Anopheles gambiae cytochrome P450 CYP4H15 protein. Length = 151 Score = 24.6 bits (51), Expect = 2.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 391 DENYFPEPYSFKPERF 344 D +PEP F PERF Sbjct: 110 DPELYPEPARFDPERF 125 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 24.2 bits (50), Expect = 3.6 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -3 Query: 391 DENYFPEPYSFKPERF 344 D FP P F PERF Sbjct: 406 DPEVFPNPEQFDPERF 421 >AY062198-1|AAL58559.1| 153|Anopheles gambiae cytochrome P450 CYP4J5 protein. Length = 153 Score = 24.2 bits (50), Expect = 3.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 391 DENYFPEPYSFKPERFL 341 D FP+P F P+RFL Sbjct: 112 DPAQFPDPERFDPDRFL 128 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 24.2 bits (50), Expect = 3.6 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 349 RFLVNGRVSLPDHYFPSVLRSI 284 R L + R LP+ YFP ++RS+ Sbjct: 258 RPLTSLREPLPEGYFPKIVRSL 279 >AY748844-1|AAV28190.1| 107|Anopheles gambiae cytochrome P450 protein. Length = 107 Score = 23.8 bits (49), Expect = 4.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 388 ENYFPEPYSFKPERF 344 E+ +P+P F PERF Sbjct: 17 EHIYPDPERFDPERF 31 >AY062191-1|AAL58552.1| 151|Anopheles gambiae cytochrome P450 CYP4H16 protein. Length = 151 Score = 23.8 bits (49), Expect = 4.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -3 Query: 379 FPEPYSFKPERF 344 FPEP F PERF Sbjct: 114 FPEPEKFIPERF 125 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 23.8 bits (49), Expect = 4.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 391 DENYFPEPYSFKPERF 344 D ++PEP F P+RF Sbjct: 416 DPAHYPEPECFDPDRF 431 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 23.8 bits (49), Expect = 4.7 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 343 LVNGRVSLPDHYFPSVLRS 287 L N R +P+ Y+P +LRS Sbjct: 273 LDNLRTPIPEPYYPKILRS 291 >AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.8 bits (49), Expect = 4.7 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 331 RVSLPDHYFPSVLRS 287 R S+P+ YFP ++RS Sbjct: 264 RESIPEAYFPKIVRS 278 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 23.4 bits (48), Expect = 6.2 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -3 Query: 391 DENYFPEPYSFKPERF 344 D + +PEP ++ P+RF Sbjct: 417 DPDIYPEPATYDPDRF 432 >AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CYP4H19 protein. Length = 151 Score = 23.4 bits (48), Expect = 6.2 Identities = 12/27 (44%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = -3 Query: 379 FPEPYSFKPERFL-VNGRVSLPDHYFP 302 FP+P F PERF N P Y P Sbjct: 114 FPDPERFDPERFSGANQHPPGPYDYIP 140 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.4 bits (48), Expect = 6.2 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 204 VPGEGLPSLDHMDGATPSAAP 142 VPG GLP+ GA PSA P Sbjct: 3225 VPGSGLPAAAASGGA-PSAMP 3244 >U50474-1|AAA93476.1| 62|Anopheles gambiae protein ( Anopheles gambiae putativetrypsin-like enzyme precursor, mRNA, partial cds. ). Length = 62 Score = 23.0 bits (47), Expect = 8.2 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 159 WLRPYDPRTADLPPVQAPARTS 224 W+ Y R +D+PP A R S Sbjct: 41 WIHRYRVRISDVPPTPALPRPS 62 >AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.0 bits (47), Expect = 8.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 361 RNTAPGSSSRQVECSCSY*LPLCLRPIVHAR 453 R +A G ++CSC+Y LR I+H R Sbjct: 26 RLSAMGLGGNTIQCSCNY--VKFLRNILHNR 54 >AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.0 bits (47), Expect = 8.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 361 RNTAPGSSSRQVECSCSY*LPLCLRPIVHAR 453 R +A G ++CSC+Y LR I+H R Sbjct: 26 RLSAMGLGGNTIQCSCNY--VKFLRNILHNR 54 >AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.0 bits (47), Expect = 8.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 361 RNTAPGSSSRQVECSCSY*LPLCLRPIVHAR 453 R +A G ++CSC+Y LR I+H R Sbjct: 26 RLSAMGLGGNTIQCSCNY--VKFLRNILHNR 54 >AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.0 bits (47), Expect = 8.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 361 RNTAPGSSSRQVECSCSY*LPLCLRPIVHAR 453 R +A G ++CSC+Y LR I+H R Sbjct: 26 RLSAMGLGGNTIQCSCNY--VKFLRNILHNR 54 >AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.0 bits (47), Expect = 8.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 361 RNTAPGSSSRQVECSCSY*LPLCLRPIVHAR 453 R +A G ++CSC+Y LR I+H R Sbjct: 26 RLSAMGLGGNTIQCSCNY--VKFLRNILHNR 54 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 23.0 bits (47), Expect = 8.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 361 RNTAPGSSSRQVECSCSY*LPLCLRPIVHAR 453 R +A G ++CSC+Y LR I+H R Sbjct: 253 RLSAMGLGGNTIQCSCNY--VKFLRNILHNR 281 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 625,337 Number of Sequences: 2352 Number of extensions: 12190 Number of successful extensions: 161 Number of sequences better than 10.0: 117 Number of HSP's better than 10.0 without gapping: 143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 161 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -