BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0047.Seq (847 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC664.09 |ggt1||gamma-glutamyltranspeptidase Ggt1 |Schizosacch... 27 2.5 SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomy... 26 7.7 >SPAC664.09 |ggt1||gamma-glutamyltranspeptidase Ggt1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 630 Score = 27.5 bits (58), Expect = 2.5 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +1 Query: 442 ALPNLIALQHIPLSPAGVIA--KRPHRSPFPTVAXLNGEWQIV 564 A P ++ + SP IA KRP S PT+ NGE ++V Sbjct: 485 ASPGIVNAFGLSPSPYNFIAPGKRPQSSAVPTILVYNGEVEMV 527 >SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 2052 Score = 25.8 bits (54), Expect = 7.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 602 VKSAHFLTNRPKSAKSLINQKNRP 673 VK FLTN + SL+ Q NRP Sbjct: 675 VKDYDFLTNLNATTLSLLTQSNRP 698 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,390,459 Number of Sequences: 5004 Number of extensions: 68674 Number of successful extensions: 121 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 121 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 418457710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -