BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0047.Seq (847 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g67270.1 68418.m08480 microtubule-associated EB1 family prote... 32 0.55 At2g43930.1 68415.m05460 protein kinase family protein contains ... 29 3.9 >At5g67270.1 68418.m08480 microtubule-associated EB1 family protein similar to SP|Q9UPY8 Microtubule-associated protein RP/EB family member 3 (Protein EB3) {Homo sapiens}; contains Pfam profiles PF00307: Calponin homology (CH) domain, PF03271: EB1 protein Length = 329 Score = 31.9 bits (69), Expect = 0.55 Identities = 16/50 (32%), Positives = 29/50 (58%) Frame = -3 Query: 203 PTSTLTEEHRDRILILNRRFLERRLTDDISANVSVSPRMRCTDSAAHKCN 54 P + +EE R+ + +R L L D++A ++SPR R +D++ KC+ Sbjct: 272 PIAEGSEERRNSVTESQKRKLIVNLDVDVAAITTLSPRQRLSDASDVKCS 321 >At2g43930.1 68415.m05460 protein kinase family protein contains similarity to NPK1-related protein kinase 2 GI:2342425 from [Arabidopsis thaliana] Length = 204 Score = 29.1 bits (62), Expect = 3.9 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -2 Query: 300 EPRSYSIIPCTKYSSTFLARFEHSNLFKVKLSAHLDTHR 184 EP ++ C K S F + FEH LFK + + H+ Sbjct: 63 EPHIVLLLQCRKKSWCFASEFEHLKLFKGYIDEDEERHK 101 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,940,208 Number of Sequences: 28952 Number of extensions: 370847 Number of successful extensions: 771 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 747 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 771 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1960634400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -