BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0044.Seq (642 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC16C9.07 |ppk5|SPAC2G11.01, mug189|serine/threonine protein k... 26 5.3 SPAC823.12 |||zinc finger protein Pep5/Vps11 |Schizosaccharomyce... 25 7.0 >SPAC16C9.07 |ppk5|SPAC2G11.01, mug189|serine/threonine protein kinase Ppk5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 836 Score = 25.8 bits (54), Expect = 5.3 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 142 SPRSLIVDSCSKLEQHSTLSRSILLI 65 SP +L +CS L HST + L+ Sbjct: 28 SPNNLTEQTCSPLRAHSTFKEPVFLL 53 >SPAC823.12 |||zinc finger protein Pep5/Vps11 |Schizosaccharomyces pombe|chr 1|||Manual Length = 906 Score = 25.4 bits (53), Expect = 7.0 Identities = 16/65 (24%), Positives = 28/65 (43%) Frame = -1 Query: 348 YXDTSVLRNNLCIVRHISWX*SSYDITIMHLDNSXXFLYRSPLGGSQTRCTEVRXXFTSI 169 + D S+ ++ ++ I S I+ LDN L+ + GG+ T T + F+ Sbjct: 43 FGDVSIYNSSFKSLQSIKVEDESSIQQILWLDNKTFLLFSNVEGGTGTNSTVIIYAFSQA 102 Query: 168 DGFSP 154 D P Sbjct: 103 DENEP 107 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,357,939 Number of Sequences: 5004 Number of extensions: 43650 Number of successful extensions: 76 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -