BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0044.Seq (642 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49525| Best HMM Match : 2-Hacid_dh_C (HMM E-Value=5.2e-10) 28 7.4 >SB_49525| Best HMM Match : 2-Hacid_dh_C (HMM E-Value=5.2e-10) Length = 779 Score = 27.9 bits (59), Expect = 7.4 Identities = 19/70 (27%), Positives = 29/70 (41%) Frame = -3 Query: 634 YYMFERSVPWKSQFISTNPIPCXXCXFQQICNWVS*GITVRIQVIFISAFLSS*TAIKFX 455 Y++ R++ FI + +P F C WV ++ + F +AFLS I Sbjct: 384 YHLVVRTLILSDCFIPLSGLPMSVASFLN-CGWVGGQVSCTLSAFFSTAFLSWSALIVVI 442 Query: 454 TGAXAFSLVT 425 A F VT Sbjct: 443 MCALRFLAVT 452 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,823,965 Number of Sequences: 59808 Number of extensions: 339887 Number of successful extensions: 517 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 517 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -