BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0044.Seq (642 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024810-8|AAU20830.1| 1446|Caenorhabditis elegans Hypothetical ... 29 3.7 Z69384-5|CAA93419.2| 408|Caenorhabditis elegans Hypothetical pr... 27 8.6 >AC024810-8|AAU20830.1| 1446|Caenorhabditis elegans Hypothetical protein Y54E10A.11 protein. Length = 1446 Score = 28.7 bits (61), Expect = 3.7 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = -3 Query: 625 FERSVPWKSQFISTNPIPCXXCXFQQICNWVS*GITVRIQVI 500 F ++PW+++ S N I C C F W+ + ++++ Sbjct: 375 FTDNLPWQAE-ASMNAIHCWFCTFSDFVKWILGNDRINLEIL 415 >Z69384-5|CAA93419.2| 408|Caenorhabditis elegans Hypothetical protein T11G6.8 protein. Length = 408 Score = 27.5 bits (58), Expect = 8.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 209 WDPPKGERYKNXXLLSRC 262 W P KG RYKN L C Sbjct: 58 WQPGKGARYKNTELCQTC 75 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,081,482 Number of Sequences: 27780 Number of extensions: 246390 Number of successful extensions: 482 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 482 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1427403330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -