BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0037.Seq (455 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo... 31 0.063 SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 comple... 26 2.4 SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk... 26 3.1 SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces ... 25 4.2 SPAC1071.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 5.5 >SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizosaccharomyces pombe|chr 3|||Manual Length = 979 Score = 31.5 bits (68), Expect = 0.063 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +3 Query: 219 ASEVVNFDESG*FCRSHGQVPATHLXNVCLINFRW*F---LRLPWLSRVTGNQGSIPERE 389 + E+++F E G + L C+IN W LRL +L + NQ S E++ Sbjct: 243 SKEIIDFLEKSKTLVELGMDSSCSLVAECMINETWPVDRALRLQFLIQQRNNQSSNEEQK 302 Query: 390 PEKRLP 407 EKR+P Sbjct: 303 QEKRVP 308 >SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 442 Score = 26.2 bits (55), Expect = 2.4 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 279 VLDHAICKIIQIHQNXRLRTRGPPSIGFDLIKALIP 172 ++D K IH + L + PS GF +I++L+P Sbjct: 391 LIDQGYIKGYIIHASSTLVLKKDPSFGFSVIESLMP 426 >SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 306 Score = 25.8 bits (54), Expect = 3.1 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 416 PWMW*PFLRLPLRNRTLIPRYP*QPW*SQKLPS 318 P MW P N+ + YP +PW S+ LPS Sbjct: 236 PSMWPELSTFPDWNKFIFHEYPPKPW-SEILPS 267 >SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 25.4 bits (53), Expect = 4.2 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 414 LDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 313 L ++ S+ P + PD P T+ V+ TT+E+ Sbjct: 422 LGLINTSEINQPANLPDEPTAETSNPVSATTVEA 455 >SPAC1071.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 338 Score = 25.0 bits (52), Expect = 5.5 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 68 NGSIYQFWFLRSYSVTWITVVILELIHAIRTLTSD 172 N IY+ +F ++S++ + + I L +RT++SD Sbjct: 14 NTQIYRIFFTLTFSLSNLFLAICYLFLNVRTVSSD 48 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,839,860 Number of Sequences: 5004 Number of extensions: 33223 Number of successful extensions: 60 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 170285640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -