BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0032.Seq (843 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 28 0.080 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 5.3 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 5.3 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 28.3 bits (60), Expect = 0.080 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 499 CKRLDSKSGGPFVEADYGRGLHP 431 C +L +KS P +A G+G HP Sbjct: 44 CNKLSNKSPPPLADAAVGKGFHP 66 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.2 bits (45), Expect = 5.3 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = -2 Query: 548 PRAHAPLRWADDLRDMLQKIGFEKRRTVR*SGLWERPTSSSREIQV 411 P H P+R DD RD + E+ T R S P + + +++ Sbjct: 242 PVGHIPIRQCDDHRDRPPRHFHEEHDTRRASSRGIIPRAKIKTVKM 287 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +2 Query: 50 FFYCYRMTTNEPIT*LIVNGY 112 +FYC +T N + L+ +GY Sbjct: 58 YFYCVSITFNVHLLFLLCSGY 78 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,620 Number of Sequences: 336 Number of extensions: 3836 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23244256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -