BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0032.Seq (843 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1448 - 37434159-37434242,37434875-37434968,37435077-374352... 28 8.1 >01_06_1448 - 37434159-37434242,37434875-37434968,37435077-37435250, 37435536-37435627,37435947-37436056,37437274-37437349, 37437445-37437537,37437617-37437817 Length = 307 Score = 28.3 bits (60), Expect = 8.1 Identities = 24/109 (22%), Positives = 46/109 (42%), Gaps = 1/109 (0%) Frame = -2 Query: 512 LRDMLQKIGFEKRRTVR*SGLWERPTSSSREIQVDDHCETTSIDXTTILSVSCNRGCIAR 333 + D L+ G + VR S +W RP ++ + V+ + + + S + I Sbjct: 1 MADRLELQGRHGKSRVRVSRVWRRPAAAGGHVIVEWNVAVSVVSDCLPSYTSDDNSAIVA 60 Query: 332 SVSLGNPVLVYDRRTQQSLSLLPGTTHLSQ-CVFLFPQALD*TLLSAAR 189 + S+ N V V + + +S+ L + L+PQ + T+ A R Sbjct: 61 TDSIKNTVYVKAKECTEIVSMEEFAVILGRHFTSLYPQVSEATVTIAER 109 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,532,624 Number of Sequences: 37544 Number of extensions: 402222 Number of successful extensions: 947 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 947 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2338704516 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -