BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0032.Seq (843 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50890.1 68414.m05722 expressed protein 30 1.7 At4g28450.1 68417.m04071 transducin family protein / WD-40 repea... 28 8.9 >At1g50890.1 68414.m05722 expressed protein Length = 821 Score = 30.3 bits (65), Expect = 1.7 Identities = 21/53 (39%), Positives = 27/53 (50%) Frame = -2 Query: 275 SLLPGTTHLSQCVFLFPQALD*TLLSAARSL*CVHLQTRCNSSDPLILLVCQS 117 SLLP LSQ + PQ+L+ L S L C + TR ++D LI L S Sbjct: 228 SLLPVVGSLSQVGAIAPQSLESLLHSIHECLGCTNWVTRKAAADVLISLAVHS 280 >At4g28450.1 68417.m04071 transducin family protein / WD-40 repeat family protein SOF1 (involved in rRNA processing) protein-yeast Length = 442 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +2 Query: 389 LWSHNDHQPVSLYYWM*ASPI-VRFN 463 +W+HN QPV + W S I VRFN Sbjct: 177 IWNHNRSQPVQSFQWGTDSVISVRFN 202 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,494,088 Number of Sequences: 28952 Number of extensions: 315766 Number of successful extensions: 680 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1950880000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -